Use Able AI chat for product recommendations

MITF Recombinant monoclonal antibody

MITF Uni-rAb® Recombinant Antibody for WB, FC (Intra), ELISA

Cat No. 83803-1-RR
Clone No.240815B4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, FC (Intra), ELISA

bHLHe32, Class E basic helix-loop-helix protein 32, MI, Microphthalmia-associated transcription factor, WS2A

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, Jurkat cells
Positive FC (Intra) detected inHeLa cells, SW480 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

83803-1-RR targets MITF in WB, FC (Intra), ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag3679

Product name: Recombinant human MITF protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-91 aa of BC012503

Sequence: MLEMLEYNHYQVQTHLENPTKYHIQQAQRQQVKQYLSTTLANKHANQVLSLPCPNQPGDHVMPPVPGSSAPNSPMAMLTLNSNCEKEFMKQ

Predict reactive species
Full Name microphthalmia-associated transcription factor
Calculated Molecular Weight 91 aa, 10 kDa, 59 kDa
Observed Molecular Weight 60-65 kDa
GenBank Accession NumberBC012503
Gene Symbol MITF
Gene ID (NCBI) 4286
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO75030
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The retinal pigment epithelium (RPE) has a essential role in maintaining visual function and dedifferentiation of RPE contributes to the pathophysiology of several ocular diseases (PMID:22523078). Microphthalmia-associated transcription factor (MITF) is a key regulator of RPE differentiation that is also down-regulated in dedifferentiated hfRPE cells. MITF is a basic helix-loop-helix (hHLH)-leucine zipper protein that involves in the development of various cell types, including neural crest-derived melanocytes and optic cup-derived retinal pigment epithelial cells (PMID: 10578055).

Protocols

Product Specific Protocols
WB protocol for MITF antibody 83803-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...