MIXL1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MIXL1 Polyclonal antibody, PBS Only (22772-1-PBS)

• 

  WB analysis of HEK-293 using 22772-1-AP (same clone as 22772-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 22772-1-AP (MIXL1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22772-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat pancreas using 22772-1-AP (same clone as 22772-1-PBS)

  rat pancreas tissue were subjected to SDS PAGE followed by western blot with 22772-1-AP (MIXL1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22772-1-PBS in a different storage buffer formulation.

• 

  WB analysis of H7ES using 22772-1-AP (same clone as 22772-1-PBS)

  H7ES cells were subjected to SDS PAGE followed by western blot with 22772-1-AP (MIXL1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22772-1-PBS in a different storage buffer formulation.

MIXL1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 22772-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, Indirect ELISA

Synonyms

hMix, Homeobox protein MIXL1, MILD1, MIX, Mix.1 homeobox-like protein

---

Product Information

22772-1-PBS targets MIXL1 in WB, Indirect ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18732

  Product name: Recombinant human MIXL1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 147-232 aa of BC113441

  Sequence: KSFQPLARPEIILNHCAPGTETKCLKPQLPLEVDVNCLPEPNGVGGGISDSSSQGQNFETCSPLSEDIGSKLDSWEEHIFSAFGNF

• Full Name: Mix1 homeobox-like 1 (Xenopus laevis)
• Calculated Molecular Weight: 232 aa, 25 kDa
• Observed Molecular Weight: 20 kDa
• GenBank Accession Number: BC113441
• Gene Symbol: MIXL1
• Gene ID (NCBI): 83881
• RRID: AB_2879164
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q9H2W2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Mix1 homeobox-like 1 (MIXL1) Transcription factor that play a central role in proper axial mesendoderm morphogenesis and endoderm formation. Required for efficient differentiation of cells from the primitive streak stage to blood, by acting early in the recruitment and/or expansion of mesodermal progenitors to the hemangioblastic and hematopoietic lineages. Also involved in the morphogenesis of the heart and the gut during embryogenesis. Acts as a negative regulator of brachyury expression. This antibody is specific to MIXL1.