MLF1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MLF1 Polyclonal antibody, PBS Only (13100-1-PBS)

• 

  WB analysis of mouse heart using 13100-1-AP (same clone as 13100-1-PBS)

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 13100-1-AP (MLF1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13100-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human brain using 13100-1-AP (same clone as 13100-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 13100-1-AP (MLF1 antibody) at dilution of 1:0 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13100-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse testis using 13100-1-AP (same clone as 13100-1-PBS)

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 13100-1-AP (MLF1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13100-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse heart using 13100-1-AP (same clone as 13100-1-PBS)

  IP result of anti-MLF1 (IP:13100-1-AP, 4ug; Detection:13100-1-AP 1:500) with mouse heart tissue lysate 4000ug. This data was developed using the same antibody clone with 13100-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 13100-1-AP (same clone as 13100-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 13100-1-AP (MLF1 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13100-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 13100-1-AP (same clone as 13100-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 13100-1-AP (MLF1 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13100-1-PBS in a different storage buffer formulation.

MLF1 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 13100-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

myeloid leukemia factor 1, Myelodysplasia-myeloid leukemia factor 1

---

Product Information

13100-1-PBS targets MLF1 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3727

  Product name: Recombinant human MLF1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-268 aa of BC007045

  Sequence: MFRMLNSSFEDDPFFSESILAHRENMRQMIRSFSEPFGRDLLSISDGRGRAHNRRGHNDGEDSLTHTDVSSFQTMDQMVSNMRNYMQKLERNFGQLSVDPNGHSFCSSSVMTYSKIGDEPPKVFQASTQTRRAPGGIKETRKAMRDSDSGLEKMAIGHHIHDRAHVIKKSKNKKTGDEEVNQEFINMNESDAHAFDEEWQSEVLKYKPGRHNLGNTRMRSVGHENPGSRELKRREKPQQSPAIEHGRRSNVLGDKLHIKGSSVKSNKK

• Full Name: myeloid leukemia factor 1
• Calculated Molecular Weight: 268 aa, 31 kDa
• Observed Molecular Weight: 31 kDa
• GenBank Accession Number: BC007045
• Gene Symbol: MLF1
• Gene ID (NCBI): 4291
• RRID: AB_2147670
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P58340
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.