MLF2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MLF2 Polyclonal antibody, PBS Only (11835-1-PBS)

• 

  WB analysis of human brain using 11835-1-AP (same clone as 11835-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 11835-1-AP (MLF2 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11835-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human gliomas using 11835-1-AP (same clone as 11835-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 11835-1-AP (MLF2 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11835-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human gliomas using 11835-1-AP (same clone as 11835-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 11835-1-AP (MLF2 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11835-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 11835-1-AP (same clone as 11835-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using 11835-1-AP (MLF2 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 11835-1-PBS in a different storage buffer formulation.

MLF2 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 11835-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

11835-1-PBS targets MLF2 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2270

  Product name: Recombinant human MLF2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-248 aa of BC000898

  Sequence: MFRFMRDVEPEDPMFLMDPFAIHRQHMSRMLSGGFGYSPFLSITDGNMPGTRPASRRMQQAGAVSPFGMLGMSGGFMDMFGMMNDMIGNMEHMTAGGNCQTFSSSTVISYSNTGDGAPKVYQETSEMRSAPGGIRETRRTVRDSDSGLEQMSIGHHIRDRAHILQRSRNHRTGDQEERQDYINLDESEAAAFDDEWRRETSRFRQQRPLEFRRLESSGAGGRRAEGPPRLAIQGPEDSPSRQSRRYDW

• Full Name: myeloid leukemia factor 2
• Calculated Molecular Weight: 248 aa, 28 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC000898
• Gene Symbol: MLF2
• Gene ID (NCBI): 8079
• RRID: AB_2235413
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15773
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.