MLPH Recombinant monoclonal antibody, PBS Only (Capture)

• 

  WB analysis using 84282-1-RR (same clone as 84282-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84282-1-RR (MLPH antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84282-1-PBS in a different storage buffer formulation.

• 

  Sandwich ELISA standard curve of MP01196-3

  Sandwich ELISA standard curve of MP01196-3, Human MLPH Recombinant Matched Antibody Pair - PBS only. 84282-1-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag32931. 84282-4-PBS was HRP conjugated as the detection antibody. Range: 39.1-2500 pg/mL.

• 

  Sample test of MP01196-3

  The mean MLPH concentration was determined to be 5.9 ng/mL in A549 cell extract based on a 1.5 mg/mL extract load and 1.7 ng/mL in HT-29 cell extract based on a 1.5 mg/mL extract load.

• 

  IHC staining of human skin cancer using 84282-1-RR (same clone as 84282-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 84282-1-RR (MLPH antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84282-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skin cancer using 84282-1-RR (same clone as 84282-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 84282-1-RR (MLPH antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84282-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84282-1-RR

  Biolayer interferometry (BLl) kinetic assays of 84282-1-RR against Human MLPH were performed. The affinity constant is 2.43 nM.

MLPH Uni-rAb^® Recombinant Antibody for WB, IHC, Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 84282-1-PBS

Clone No.241621G4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

241621G4, Exophilin 3, Exophilin-3, Melanophilin, SLAC2 A

---

Product Information

84282-1-PBS targets MLPH as part of a matched antibody pair:

MP01196-3: 84282-1-PBS capture and 84282-4-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag32931

  Product name: Recombinant human MLPH protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 372-600 aa of BC001653

  Sequence: AGVRTEADVEEEALRRKLEELTSNVSDQETSSEEEEAKDEKAEPNRDKSVGPLPQADPEVGTAAHQTNRQEKSPQDPGDPVQYNRTTDEELSELEDRVAVTASEVQQAESEVSDIESRIAALRAAGLTVKPSGKPRRKSNLPIFLPRVAGKLGKRPEDPNADPSSEAKAMAVPYLLRRKFSNSLKSQGKDDDSFDRKSVYRGSLTQRNPNARKGMASHTFAKPVVAHQS

• Full Name: melanophilin
• Calculated Molecular Weight: 66 kDa
• Observed Molecular Weight: 66 kDa, 80 kDa
• GenBank Accession Number: BC001653
• Gene Symbol: MLPH
• Gene ID (NCBI): 79083
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9BV36
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Melanophilin (Mlph) is a member of the exophilin subfamily of Rab effector proteins. MLPH is a modular protein, forming a ternary complex with the small Ras-related GTPase Rab27A in its GTP-bound form and the motor protein myosin Va. It regulates retention of melanosomes at the peripheral actin cytoskeleton of melanocytes, a process essential for normal mammalian pigmentation. Defects in MLPH are a cause of Griscelli syndrome type 3 (GS3), which is characterized by a silver-gray hair color and abnormal pigment distribution in the hair shaft.