Use Able AI chat for product recommendations

MLPH Recombinant monoclonal antibody, PBS Only (Capture)

MLPH Uni-rAb® Recombinant Antibody for WB, IHC, Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 84282-1-PBS
Clone No.241621G4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Sandwich ELISA, Indirect ELISA, Sample test

241621G4, Exophilin 3, Exophilin-3, Melanophilin, SLAC2 A

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84282-1-PBS targets MLPH as part of a matched antibody pair:

MP01196-3: 84282-1-PBS capture and 84282-4-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag32931

Product name: Recombinant human MLPH protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 372-600 aa of BC001653

Sequence: AGVRTEADVEEEALRRKLEELTSNVSDQETSSEEEEAKDEKAEPNRDKSVGPLPQADPEVGTAAHQTNRQEKSPQDPGDPVQYNRTTDEELSELEDRVAVTASEVQQAESEVSDIESRIAALRAAGLTVKPSGKPRRKSNLPIFLPRVAGKLGKRPEDPNADPSSEAKAMAVPYLLRRKFSNSLKSQGKDDDSFDRKSVYRGSLTQRNPNARKGMASHTFAKPVVAHQS

Predict reactive species
Full Name melanophilin
Calculated Molecular Weight 66 kDa
Observed Molecular Weight66 kDa, 80 kDa
GenBank Accession NumberBC001653
Gene Symbol MLPH
Gene ID (NCBI) 79083
RRIDAB_3671828
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9BV36
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Melanophilin (Mlph) is a member of the exophilin subfamily of Rab effector proteins. MLPH is a modular protein, forming a ternary complex with the small Ras-related GTPase Rab27A in its GTP-bound form and the motor protein myosin Va. It regulates retention of melanosomes at the peripheral actin cytoskeleton of melanocytes, a process essential for normal mammalian pigmentation. Defects in MLPH are a cause of Griscelli syndrome type 3 (GS3), which is characterized by a silver-gray hair color and abnormal pigment distribution in the hair shaft.

Loading...
||
New chat

Able

正在加载,请稍候...