MMGT1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MMGT1 Polyclonal antibody, PBS Only (31166-1-PBS)

• 

  WB analysis using 31166-1-AP (same clone as 31166-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31166-1-AP (MMGT1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31166-1-PBS in a different storage buffer formulation.

MMGT1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 31166-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

Transmembrane protein 32, TMEM32

---

Product Information

31166-1-PBS targets MMGT1 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35121

  Product name: Recombinant human MMGT1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 65-131 aa of BC033588

  Sequence: GEFKDMDATSELKNKTFDTLRNHPSFYVFNHRGRVLFRPSDTANSSNQDALSSNTSLKLRKLESLRR

• Full Name: membrane magnesium transporter 1
• Calculated Molecular Weight: 131 aa, 15 kDa
• Observed Molecular Weight: 15-20 kDa
• GenBank Accession Number: BC033588
• Gene Symbol: MMGT1
• Gene ID (NCBI): 93380
• RRID: AB_3742401
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q8N4V1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MMGT1 (Membrane Magnesium Transporter 1) is a protein encoded by the MMGT1 gene in humans. It is also known by the aliases EMC5 and TMEM32. This protein is a member of the magnesium transporter family and is involved in the transport of magnesium ions across cell membranes.