MMP23B Polyclonal antibody

• 

  WB analysis of A549 using 13020-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 13020-1-AP (MMP23B antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A549 using 13020-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 13020-1-AP (MMP23B antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse liver using 13020-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 13020-1-AP (MMP23B Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of PC-3 using 13020-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 13020-1-AP (MMP23B antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 13020-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 13020-1-AP (MMP23B antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 13020-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 13020-1-AP (MMP23B antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human ovary tumor using 13020-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 13020-1-AP (MMP23B Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human ovary tumor using 13020-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 13020-1-AP (MMP23B Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 13020-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 13020-1-AP (MMP23B Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 13020-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 13020-1-AP (MMP23B Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 13020-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using MMP23B antibody (13020-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-Phalloidin (red).

• 

  FC experiment of HepG2 using 13020-1-AP

  1x10^6 HepG2 cells were intracellularly stained with 0.25 ug MMP23B Polyclonal antibody (13020-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

MMP23B Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA

Cat No. 13020-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

Synonyms

EC:3.4.24.-, Femalysin, matrix metallopeptidase 23B, Matrix metalloproteinase 21, Matrix metalloproteinase 22

---

Tested Applications

• Positive WB detected in: A549 cells, HepG2 cells, mouse liver tissue, PC-3 cells
• Positive IHC detected in: human ovary tumor tissue, human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells
• Positive FC (Intra) detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:100-1:400
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IHC: See 2 publications below

Product Information

13020-1-AP targets MMP23B in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4113

  Product name: Recombinant human MMP23B protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 52-390 aa of BC025719

  Sequence: QGDVAALGLSAVPPTRVPGPLAPRRRRYTLTPARLRWDHFNLTYRILSFPRNLLSPRETRRALAAAFRMWSDVSPFSFREVAPEQPSDLRIGFYPINHTDCLVSALHHCFDGPTGELAHAFFPPHGGIHFDDSEYWVLGPTRYSWKKGVWLTDLVHVAAHEIGHALGLMHSQHGRALMHLNATLRGWKALSQDELWGLHRLYGCLDRLFVCASWARRGFCDARRRLMKRLCPSSCDFCYEFPFPTVATTPPPPRTKTRLVPEGRNVTFRCGQKILHKKGKVYWYKDQEPLEFSYPGYLALGEAHLSIIANAVNEGTYTCVVRRQQRVLTTYSWRVRVRG

• Full Name: matrix metallopeptidase 23B
• Calculated Molecular Weight: 390 aa, 44 kDa
• Observed Molecular Weight: 46-60 kDa
• GenBank Accession Number: BC025719
• Gene Symbol: MMP23B
• Gene ID (NCBI): 8510
• RRID: AB_2146152
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O75900
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MMP23B(matrix metallopeptidase 23B) is also named as MMP21, MMP22.It is a regulator in matrix remodeling and may be playing a role in enchondral bone formation and in regulation of cranial suture closure .It has 3 isoforms produced by alternative splicing with the molecular weight of 44KDa,48KDa and 46KDa,respectively.It also can be N-glycosylated.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	J Hematol Oncol; Proteogenomic insights into the biology and treatment of pancreatic ductal adenocarcinoma; Authors - Yexin Tong
human	WB,IHC	Curr Eye Res; Cohesin Complex Interacting with Promoters of MMP Genes for in Pterygium Occurrence; Authors - Shichao Han