MMP23B Polyclonal antibody

MMP23B Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA
Cat No. 13020-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

EC:3.4.24.-, Femalysin, matrix metallopeptidase 23B, Matrix metalloproteinase 21, Matrix metalloproteinase 22

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, HepG2 cells, mouse liver tissue, PC-3 cells
Positive IHC detected inhuman ovary tumor tissue, human liver cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:100-1:400
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

13020-1-AP targets MMP23B in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag4113

Product name: Recombinant human MMP23B protein

Source: e coli.-derived, T-HIS

Tag: 6*His

Domain: 52-390 aa of BC025719

Sequence: QGDVAALGLSAVPPTRVPGPLAPRRRRYTLTPARLRWDHFNLTYRILSFPRNLLSPRETRRALAAAFRMWSDVSPFSFREVAPEQPSDLRIGFYPINHTDCLVSALHHCFDGPTGELAHAFFPPHGGIHFDDSEYWVLGPTRYSWKKGVWLTDLVHVAAHEIGHALGLMHSQHGRALMHLNATLRGWKALSQDELWGLHRLYGCLDRLFVCASWARRGFCDARRRLMKRLCPSSCDFCYEFPFPTVATTPPPPRTKTRLVPEGRNVTFRCGQKILHKKGKVYWYKDQEPLEFSYPGYLALGEAHLSIIANAVNEGTYTCVVRRQQRVLTTYSWRVRVRG

Predict reactive species
Full Name matrix metallopeptidase 23B
Calculated Molecular Weight 390 aa, 44 kDa
Observed Molecular Weight 46-60 kDa
GenBank Accession NumberBC025719
Gene Symbol MMP23B
Gene ID (NCBI) 8510
RRIDAB_2146152
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO75900
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MMP23B(matrix metallopeptidase 23B) is also named as MMP21, MMP22.It is a regulator in matrix remodeling and may be playing a role in enchondral bone formation and in regulation of cranial suture closure .It has 3 isoforms produced by alternative splicing with the molecular weight of 44KDa,48KDa and 46KDa,respectively.It also can be N-glycosylated.

Protocols

Product Specific Protocols
IF protocol for MMP23B antibody 13020-1-APDownload protocol
IHC protocol for MMP23B antibody 13020-1-APDownload protocol
WB protocol for MMP23B antibody 13020-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIHC

J Hematol Oncol

Proteogenomic insights into the biology and treatment of pancreatic ductal adenocarcinoma

Authors - Yexin Tong
humanWB,IHC

Curr Eye Res

Cohesin Complex Interacting with Promoters of MMP Genes for in Pterygium Occurrence

Authors - Shichao Han
Loading...
||
New chat Able
正在加载,请稍候...