MMP25 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MMP25 Polyclonal antibody, PBS Only (30655-1-PBS)

• 

  WB analysis using 30655-1-AP (same clone as 30655-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30655-1-AP (MMP25 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30655-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse spleen using 30655-1-AP (same clone as 30655-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 30655-1-AP (MMP25 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30655-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A549 using 30655-1-AP (same clone as 30655-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A549 cells using MMP25 antibody (30655-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). This data was developed using the same antibody clone with 30655-1-PBS in a different storage buffer formulation.

MMP25 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 30655-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

MTMMP6, MT6MMP, MT MMP6, MMP 25, matrix metallopeptidase 25

---

Product Information

30655-1-PBS targets MMP25 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29304

  Product name: Recombinant human MMP25 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 260-381 aa of NM_022468

  Sequence: GDPDKYRLSQDDRDGLQQLYGKAPQTPYDKPTRKPLAPPPQPPASPTHSPSFPIPDRCEGNFDAIANIRGETFFFKGPWFWRLQPSGQLVSPRPARLHRFWEGLPAQVRVVQAAYARHRDGR

• Full Name: matrix metallopeptidase 25
• Calculated Molecular Weight: 63 kDa
• Observed Molecular Weight: 38-40 kDa
• GenBank Accession Number: NM_022468
• Gene Symbol: MMP25
• Gene ID (NCBI): 64386
• RRID: AB_3669745
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NPA2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MMP25, also known as MT6-MMP, is one of the two glycosylphosphatidylinositol anchored matrix metalloproteinases (MMPs) that have been suggested to play a role in pericellular proteolysis. MMP25 was originally cloned from human leukocytes and its mRNA is predominantly expressed in leukocytes (polymorphonuclear cells and monocytes) of normal tissues and in brain, colon, urothelial and prostate cancers (PMID: 17513868). MMP-25 can exaggerate inflammatory responses by inactivating the main antiproteinase, a1-proteinase inhibitor or serpin (PMID: 16584348). The band at 57-kDa we detected is likely to be active MT6-MMP and minor MT6-MMP degradation product of 38-kDa.