MMP26 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• MMP26 Polyclonal antibody (18087-1-AP)

MMP26 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 18087-1-AP Copied!

Publications (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Matrix metalloproteinase 26, matrix metallopeptidase 26, Matrilysin-2, Matrilysin 2, Endometase

• 

  WB analysis of SKOV-3 using 18087-1-AP

  SKOV-3 cells were subjected to SDS PAGE followed by western blot with 18087-1-AP (MMP26 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human placenta using 18087-1-AP

  human placenta tissue were subjected to SDS PAGE followed by western blot with 18087-1-AP (MMP26 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 18087-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 18087-1-AP (MMP26 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 18087-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer slide using 18087-1-AP (MMP26 Antibody) at dilution of 1:50.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 18087-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer slide using 18087-1-AP (MMP26 Antibody) at dilution of 1:50.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of SKOV-3 using 18087-1-AP

  Immunofluorescent analysis of SKOV-3 cells using 18087-1-AP (MMP26 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for MMP26 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: SKOV-3 cells, HEK-293 cells, human placenta tissue
• Positive IHC detected in: human prostate cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: SKOV-3 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

18087-1-AP targets MMP26 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12806

  Product name: Recombinant human MMP26 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 24-262 aa of BC101541

  Sequence: ADHKGWDFVEGYFHQFFLTKKESPLLTQETQTQLLQQFHRNGTDLLDMQMHALLHQPHCGVPDGSDTSISPGRCKWNKHTLTYRIINYPHDMKPSAVKDSIYNAVSIWSNVTPLIFQQVQNGDADIKVSFWQWAHEDGWPFDGPGGILGHAFLPNSGNPGVVHFDKNEHWSASDTGYNLFLVATHEIGHSLGLQHSGNQSSIMYPTYWYHDPRTFQLSADDIQRIQHLYGEKCSSDIP

• Full Name: matrix metallopeptidase 26
• Calculated Molecular Weight: 262 aa, 30 kDa
• Observed Molecular Weight: 19 kDa
• GenBank Accession Number: BC101541
• Gene Symbol: MMP26
• Gene ID (NCBI): 56547
• RRID: AB_2878495
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NRE1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MMP26(matrix metallopeptidase 26) may hydrolyze collagen type IV, fibronectin, fibrinogen, beta-casein, type I gelatin and alpha-1 proteinase inhibitor.MMP26 is expressed in placenta and uterus and is widely expressed in malignant tumors from different sources as well as in diverse tumor cell lines(PMID: 10987280).The proenzyme without the signal peptide has a calculated molecular mass of 29 kDa and the processed enzyme has a calculated molecular mass of 19 kDa(PMID:15574774).This antibody is specific to MMP26.

Publications

What published studies show

The MMP26 Polyclonal antibody (Cat# 18087-1-AP) has 2 total citations. These publications appear in Science Advances (2023) and Journal of Huazhong University of Science and Technology, Medical Sciences (2017). The research fields encompass vascular biology and trauma pathology (endotheliopathy and coagulopathy in traumatic hemorrhage) and oncology (MMP26 as a potential biomarker for prostate cancer). Both studies utilized human samples, with applications including Western blot and immunohistochemistry.

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Sci Adv; Succinate metabolism and membrane reorganization drives the endotheliopathy and coagulopathy of traumatic hemorrhage; Authors - Sarah Abdullah
human	IHC	J Huazhong Univ Sci Technolog Med Sci; MMP26: A potential biomarker for prostate cancer.; Authors - Teng Cheng