MMP26 Polyclonal antibody

• 

  WB analysis of SKOV-3 using 18087-1-AP

  SKOV-3 cells were subjected to SDS PAGE followed by western blot with 18087-1-AP (MMP26 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human placenta using 18087-1-AP

  human placenta tissue were subjected to SDS PAGE followed by western blot with 18087-1-AP (MMP26 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 18087-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 18087-1-AP (MMP26 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human prostate cancer using 18087-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer slide using 18087-1-AP (MMP26 Antibody) at dilution of 1:50.

• 

  IHC staining of human prostate cancer using 18087-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer slide using 18087-1-AP (MMP26 Antibody) at dilution of 1:50.

• 

  IF Staining of SKOV-3 using 18087-1-AP

  Immunofluorescent analysis of SKOV-3 cells using 18087-1-AP (MMP26 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

MMP26 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 18087-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Matrix metalloproteinase 26, matrix metallopeptidase 26, Matrilysin-2, Matrilysin 2, Endometase

---

Tested Applications

• Positive WB detected in: SKOV-3 cells, HEK-293 cells, human placenta tissue
• Positive IHC detected in: human prostate cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: SKOV-3 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IHC: See 1 publications below

Product Information

18087-1-AP targets MMP26 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12806

  Product name: Recombinant human MMP26 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 24-262 aa of BC101541

  Sequence: ADHKGWDFVEGYFHQFFLTKKESPLLTQETQTQLLQQFHRNGTDLLDMQMHALLHQPHCGVPDGSDTSISPGRCKWNKHTLTYRIINYPHDMKPSAVKDSIYNAVSIWSNVTPLIFQQVQNGDADIKVSFWQWAHEDGWPFDGPGGILGHAFLPNSGNPGVVHFDKNEHWSASDTGYNLFLVATHEIGHSLGLQHSGNQSSIMYPTYWYHDPRTFQLSADDIQRIQHLYGEKCSSDIP

• Full Name: matrix metallopeptidase 26
• Calculated Molecular Weight: 262 aa, 30 kDa
• Observed Molecular Weight: 19 kDa
• GenBank Accession Number: BC101541
• Gene Symbol: MMP26
• Gene ID (NCBI): 56547
• RRID: AB_2878495
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NRE1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MMP26(matrix metallopeptidase 26) may hydrolyze collagen type IV, fibronectin, fibrinogen, beta-casein, type I gelatin and alpha-1 proteinase inhibitor.MMP26 is expressed in placenta and uterus and is widely expressed in malignant tumors from different sources as well as in diverse tumor cell lines(PMID: 10987280).The proenzyme without the signal peptide has a calculated molecular mass of 29 kDa and the processed enzyme has a calculated molecular mass of 19 kDa(PMID:15574774).This antibody is specific to MMP26.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Sci Adv; Succinate metabolism and membrane reorganization drives the endotheliopathy and coagulopathy of traumatic hemorrhage; Authors - Sarah Abdullah
human	IHC	J Huazhong Univ Sci Technolog Med Sci; MMP26: A potential biomarker for prostate cancer.; Authors - Teng Cheng