MMP3 Polyclonal antibody

• 

  WB analysis using 17873-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 17873-1-AP (MMP3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 17873-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 17873-1-AP (MMP3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human skeletal muscle using 17873-1-AP

  human skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 17873-1-AP (MMP3 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A549 using 17873-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 17873-1-AP (MMP3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A2780 using 17873-1-AP

  A2780 cells were subjected to SDS PAGE followed by western blot with 17873-1-AP (MMP3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 17873-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 17873-1-AP (MMP3 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human breast cancer using 17873-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 17873-1-AP (MMP3 antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human breast cancer using 17873-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 17873-1-AP (MMP3 antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human breast cancer using 17873-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 17873-1-AP (MMP3 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human breast cancer using 17873-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 17873-1-AP (MMP3 antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human stomach cancer using 17873-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer using 17873-1-AP (MMP3 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human stomach cancer using 17873-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer using 17873-1-AP (MMP3 antibody) at dilution of 1:50 (under 40x lens).

• 

  IF Staining of A549 using 17873-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed A549 cells using MMP3 antibody (17873-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of A549 using 17873-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed A549 cells using MMP3 antibody (17873-1-AP) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CoraLite®594 Beta Actin antibody (CL594-66009, Clone: 2D4H5, red).

• Featured Product
• KD/KO Validated

The MMP3 polyclonal antibody (17873-1-AP) is one of the most highly cited MMP3 antibodies in the market. It is suitable for WB, IHC, IF/ICC, ELISA and has been referenced in over 264 publications.

Cat No. 17873-1-AP

Publications(264)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, rat and More (4)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Stromelysin-1, SL-1, MMP-3, MMP 3, Matrix metalloproteinase-3

---

Tested Applications

• Positive WB detected in: A2780 cells, A549 cells, HeLa cells, human skeletal muscle tissue, U-87 MG cells, PC-12 cells
• Positive IHC detected in: human breast cancer tissue, human stomach cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 4 publications below
• WB: See 219 publications below
• IHC: See 50 publications below
• IF: See 27 publications below
• FC: See 1 publications below

Product Information

17873-1-AP targets MMP3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Cited Reactivity: human, mouse, rat, pig, rabbit, bovine
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12359

  Product name: Recombinant human MMP3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 26-477 aa of BC074869

  Sequence: GEDTSMNLVQKYLENYYDLEKDVKQFVRRKDSGPVVKKIREMQKFLGLEVTGKLDSDTLEVMRKPRCGVPDVGHFRTFPGIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLYHSLTDLTRFRLSQDDINGIQSLYGPPPDSPETPLVPTEPVPPEPGTPANCDPALSFDAVSTLRGEILIFKDRHFWRKSLRKLEPELHLISSFWPSLPSGVDAAYEVTSKDLVFIFKGNQFWAIRGNEVRAGYPRGIHTLGFPPTVRKIDAAISDKEKNKTYFFVEDKYWRFDEKRNSMEPGFPKQIAEDFPGIDSKIDAVFEEFGFFYFFTGSSQLEFDPNAKKVTHTLKSNSWLNC

• Full Name: matrix metallopeptidase 3 (stromelysin 1, progelatinase)
• Calculated Molecular Weight: 477 aa, 54 kDa
• Observed Molecular Weight: 45-60 kDa
• GenBank Accession Number: BC074869
• Gene Symbol: MMP3
• Gene ID (NCBI): 4314
• RRID: AB_2146587
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P08254
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Matrix metalloproteinases (MMPs) play a critically important role in extracellular matrix remodeling and have been implicated in a number of key normal and pathologic processes.These proteases have come to represent important therapeutic and diagnostic targets for the treatment and detection of human cancers. MMP-3 activate procollagenase via two pathways: slow direct activation and rapid activation in conjunction with tissue or plasma proteinases. The pro-MMP3 (60 kDa) and the active MMP3 (47 kDa) can be detected through western blot.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	Protein Cell; Skin organoid transplantation promotes tissue repair with scarless in frostbite; Authors - Wenwen Wang
human,rat	WB,IHC	Cell Rep Med; Microneedle delivery of CAR-M-like engineered macrophages alleviates intervertebral disc degeneration through enhanced efferocytosis capacity; Authors - Xingyu Zhou
rat	WB	Adv Sci (Weinh); DNA Origami-Based CD44-Targeted Therapy Silences Stat3 Enhances Cartilage Regeneration and Alleviates Osteoarthritis Progression; Authors - Qi Lv
mouse,rat	WB,IF	Autophagy; Phosphorylation of KRT8 (keratin 8) by excessive mechanical load-activated PKN (protein kinase N) impairs autophagosome initiation and contributes to disc degeneration; Authors - Di Wang
human	IHC	Bone Res; FABP4 secreted by M1-polarized macrophages promotes synovitis and angiogenesis to exacerbate rheumatoid arthritis.; Authors - Dong Guo
human	WB	Mater Today Bio; Platelet-derived extracellular vesicles ameliorate intervertebral disc degeneration by alleviating mitochondrial dysfunction; Authors - Zhanqiu Dai

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Ana Luísa (Verified Customer) (07-25-2022)

Permeabilization: 0,3% Triton X-100 Blocking 2,5% BSA + 0,1% Triton X-100

• Applications: Immunofluorescence
• Primary Antibody Dilution: 1:100
• Cell Tissue Type: Intervertebral disc cells