MMP3 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 82984-4-RR (same clone as 82984-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 82984-4-RR (MMP3 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 82984-4-PBS in a different storage buffer formulation.

• 

  FC experiment of HepG2 using 82984-4-RR (same clone as 82984-4-PBS)

  1x10^6 HepG2 cells were intracellularly stained with 0.4 ug MMP3 Recombinant antibody (82984-4-RR, Clone:230535G8) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.4 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C). This data was developed using the same antibody clone with 82984-4-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 82984-4-RR

  Biolayer interferometry (BLl) kinetic assays of 82984-4-RR against Human MMP3 were performed. The affinity constant is 0.348 nM.

MMP3 Uni-rAb^® Recombinant Antibody for WB, FC (Intra), Cytometric bead array, Indirect ELISA

Cat No. 82984-4-PBS

Clone No.230535G8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, FC (Intra), Cytometric bead array, Indirect ELISA

Synonyms

230535G8, EC:3.4.24.17, Matrix metalloproteinase-3, MMP 3, MMP-3

---

Product Information

82984-4-PBS targets MMP3 in WB, FC (Intra), Cytometric bead array, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0382

  Product name: Recombinant Human MMP-3 protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 18-477 aa of BC074815

  Sequence: YPLDGAARGEDTSMNLVQKYLENYYDLKKDVKQFVRRKDSGPVVKKIREMQKFLGLEVTGKLDSDTLEVMRKPRCGVPDVGHFRTFPGIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLYHSLTDLTRFRLSQDDINGIQSLYGPPPDSPETPLVPTEPVPPEPGTPANCDPALSFDAVSTLRGEILIFKDRHFWRKSLRKLEPELHLISSFWPSLPSGVDAAYEVTSKDLVFIFKGNQFWAIRGNEVRAGYPRGIHTLGFPPTVRKIDAAISDKEKNKTYFFVEDKYWRFDEKRNSMEPGFPKQIAEDFPGIDSKIDAVFEEFGFFYFFTGSSQLEFDPNAKKVTHTLKSNSWLNC

• Full Name: matrix metallopeptidase 3 (stromelysin 1, progelatinase)
• GenBank Accession Number: BC074815
• Gene Symbol: MMP3
• Gene ID (NCBI): 4314
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P08254
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.