Anti-Rat MMP8 Rabbit Recombinant Antibody, PBS Only

• 

  FC experiment of Transfected HEK-293T using 98361-3-RR (same clone as 98361-3-PBS)

  1x10^6 HEK-293T cells (left) or MMP8 transfected HEK-293T cells (right) were intracellularly stained with 0.25 ug Anti-Rat MMP8 Rabbit RecAb (98361-3-RR, Clone: 242473B12) and PE-conjugated Goat Anti-Rabbit IgG. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 98361-3-PBS in a different storage buffer formulation.

• 

  FC experiment of Transfected HEK-293T using 98361-3-RR (same clone as 98361-3-PBS)

  1x10^6 HEK-293T cells (left) or MMP8 transfected HEK-293T cells (right) were intracellularly stained with 0.25 ug Anti-Rat MMP8 Rabbit RecAb (98361-3-RR, Clone:242473B12) (red) or Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and PE-conjugated Goat Anti-Rabbit IgG. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 98361-3-PBS in a different storage buffer formulation.

MMP8 Uni-rAb^® Recombinant Antibody for FC (Intra)

Cat No. 98361-3-PBS

Clone No.242473B12

Host / Isotype

Rabbit / IgG

Reactivity

rat

Applications

FC (Intra)

Synonyms

EC:3.4.24.34, Matrix metalloproteinase-8, MMP-8, Neutrophil collagenase

---

Product Information

98361-3-PBS targets MMP8 in FC (Intra) applications and shows reactivity with rat samples.

• Tested Reactivity: rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3278

  Product name: Recombinant Rat MMP-8 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 21-466 aa of NM_022221.1

  Sequence: LPVPPEHLEEKNMKTAENYLRKFYHLPSNQFRSARNATMIAEKLKEMQRFFGLPETGKPDAATIEIMEKPRCGVPDSGDFLLTPGSPKWTHTNLTYRIINHTPQMSKAEVKTEIEKAFKIWSVPSTLTFTETLEGEADINIAFVSRDHGDNSPFDGPNGILAHAFQPGRGIGGDAHFDSEETWTQDSKNYNLFLVAAHEFGHSLGLSHSTDPGALMYPNYAYREPSTYSLPQDDINGIQTIYGPSDNPVQPTGPSTPTACDPHLRFDAATTLRGEIYFFKDKYFWRRHPQLRTVDLNFISLFWPFLPNGLQAAYEDFDRDLVFLFKGRQYWALSAYDLQQGYPRDISNYGFPRSVQAIDAAVSYNGKTYFFVNNQCWRYDNQRRSMDPGYPTSIASVFPGINCRIDAVFQQDSFFLFFSGPQYFAFNLVSRRVTRVARSNLWLNCP

• Full Name: matrix metallopeptidase 8
• Calculated Molecular Weight: 53 kDa
• GenBank Accession Number: NM_022221.1
• Gene Symbol: Mmp8
• Gene ID (NCBI): 63849
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O88766
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MMP8(Matrix metalloproteinase-8) an enzyme that degrades fibrillar collagens imparting strength to the fetal membranes, is expressed by leukocytes and chorionic cytotrophoblast cells(PMID:15367487).