Anti-Rat MMP8 Rabbit Recombinant Antibody

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• Anti-Rat MMP8 Rabbit Recombinant Antibody (98361-3-RR)

• 

  FC experiment of Transfected HEK-293T using 98361-3-RR

  1x10^6 HEK-293T cells (left) or MMP8 transfected HEK-293T cells (right) were intracellularly stained with 0.25 ug Anti-Rat MMP8 Rabbit RecAb (98361-3-RR, Clone: 242473B12) and PE-conjugated Goat Anti-Rabbit IgG. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• 

  FC experiment of Transfected HEK-293T using 98361-3-RR

  1x10^6 HEK-293T cells (left) or MMP8 transfected HEK-293T cells (right) were intracellularly stained with 0.25 ug Anti-Rat MMP8 Rabbit RecAb (98361-3-RR, Clone:242473B12) (red) or Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and PE-conjugated Goat Anti-Rabbit IgG. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

MMP8 Uni-rAb^® Recombinant Antibody for FC (Intra)

Cat No. 98361-3-RR

Clone No.242473B12

Host / Isotype

Rabbit / IgG

Reactivity

rat

Applications

FC (Intra)

Synonyms

EC:3.4.24.34, Matrix metalloproteinase-8, MMP-8, Neutrophil collagenase

---

Tested Applications

• Positive FC (Intra) detected in: Transfected HEK-293T cells

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in 100 μl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

98361-3-RR targets MMP8 in FC (Intra) applications and shows reactivity with rat samples.

• Tested Reactivity: rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3278

  Product name: Recombinant Rat MMP-8 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 21-466 aa of NM_022221.1

  Sequence: LPVPPEHLEEKNMKTAENYLRKFYHLPSNQFRSARNATMIAEKLKEMQRFFGLPETGKPDAATIEIMEKPRCGVPDSGDFLLTPGSPKWTHTNLTYRIINHTPQMSKAEVKTEIEKAFKIWSVPSTLTFTETLEGEADINIAFVSRDHGDNSPFDGPNGILAHAFQPGRGIGGDAHFDSEETWTQDSKNYNLFLVAAHEFGHSLGLSHSTDPGALMYPNYAYREPSTYSLPQDDINGIQTIYGPSDNPVQPTGPSTPTACDPHLRFDAATTLRGEIYFFKDKYFWRRHPQLRTVDLNFISLFWPFLPNGLQAAYEDFDRDLVFLFKGRQYWALSAYDLQQGYPRDISNYGFPRSVQAIDAAVSYNGKTYFFVNNQCWRYDNQRRSMDPGYPTSIASVFPGINCRIDAVFQQDSFFLFFSGPQYFAFNLVSRRVTRVARSNLWLNCP

• Full Name: matrix metallopeptidase 8
• Calculated Molecular Weight: 53 kDa
• GenBank Accession Number: NM_022221.1
• Gene Symbol: Mmp8
• Gene ID (NCBI): 63849
• RRID: AB_3746011
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O88766
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Background Information

Matrix metalloproteinase 8 (MMP-8), also known as collagenase 2 or neutrophil collagenase, belongs to the family of matrix metalloproteinases (MMPs). As an enzyme that degrades fibrillar collagens imparting strength to the fetal membranes, MMP8 is expressed by leukocytes and chorionic cytotrophoblast cells (PMID:15367487). MMP-8 has physiological roles in tissue remodeling of the ECM during tissue injury and wound healing.