MMP-9 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of supernatant of U2OS using 82685-20-RR (same clone as 82685-20-PBS)

  PMA treated supernatant of U2OS cells were subjected to SDS PAGE followed by western blot with 82685-20-RR (MMP-9 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 82685-20-PBS in a different storage buffer formulation.

• 

  WB analysis of human saliva using 82685-20-RR (same clone as 82685-20-PBS)

  human saliva were subjected to SDS PAGE followed by western blot with 82685-20-RR (MMP-9 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 82685-20-PBS in a different storage buffer formulation.

• 

  Affinity of 82685-20-RR

  Biolayer interferometry (BLl) kinetic assays of 82685-20-RR against Human MMP-9 were performed. The affinity constant is 31.5 pM.

MMP-9 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 82685-20-PBS

Clone No.250225B11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

MMP9, 67 kDa matrix metalloproteinase-9, 82 kDa matrix metalloproteinase-9, CLG4B, EC:3.4.24.35

---

Product Information

82685-20-PBS targets MMP-9 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0442

  Product name: Recombinant Human MMP9 protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*His

  Domain: 20-707 aa of BC006093

  Sequence: APRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRSYSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTRDGNADGKPCQFPFIFQGQSYSACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYSTCTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVHPSERPTAGPTGPPSAGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYWRFSEGRGSRPQGPFLIADKWPALPRKLDSVFEERLSKKLFFFSGRQVWVYTGASVLGPRRLDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPED

• Full Name: matrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase)
• Calculated Molecular Weight: 707 aa, 78 kDa
• Observed Molecular Weight: 92 kDa
• GenBank Accession Number: BC006093
• Gene Symbol: MMP-9
• Gene ID (NCBI): 4318
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P14780
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, tissue remodeling, and disease processes, such as arthritis or metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. Matrix metalloproteinase 9 (gelatinase B, 92 kDa gelatinase, 92 kDa type IV collagenase) (MMP9, synonyms: GELB, CLG4B) degrades collagens type IV and V. Studies in rhesus monkeys suggest that MMP9 is involved in IL-8-induced mobilization hematopoietic progenitor cells from bone marrow, and murine studies suggest a role in tumor-associated tissue remodeling. The pro-MMP9 is 92 kDa, and it can be detected a processed form of 68 kDa. This protein can exist as a dimer of 180 kDa (PMID:7492685).