MOBKL2A Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MOBKL2A Polyclonal antibody, PBS Only (16942-1-PBS)

• 

  WB analysis of mouse thymus using 16942-1-AP

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 16942-1-AP (MOBKL2A antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse thymus using 16942-1-AP (same clone as 16942-1-PBS)

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 16942-1-AP (MOBKL2A Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16942-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 16942-1-AP (same clone as 16942-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 16942-1-AP (MOBKL2A Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16942-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Raji using 16942-1-AP (same clone as 16942-1-PBS)

  Raji cells were subjected to SDS PAGE followed by western blot with 16942-1-AP (MOBKL2A Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16942-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse lymph using 16942-1-AP (same clone as 16942-1-PBS)

  mouse lymph tissue were subjected to SDS PAGE followed by western blot with 16942-1-AP (MOBKL2A antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16942-1-PBS in a different storage buffer formulation.

MOBKL2A Polyclonal Antibody for WB, ELISA

Cat No. 16942-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

---

Product Information

16942-1-PBS targets MOBKL2A in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10540

  Product name: Recombinant human MOBKL2A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-217 aa of BC015049

  Sequence: MSNPFLKQVFNKDKTFRPKRKFEPGTQRFELHKKAQASLNAGLDLRLAVQLPPGEDLNDWVAVHVVDFFNRVNLIYGTISDGCTEQSCPVMSGGPKYEYRWQDEHKFRKPTALSAPRYMDLLMDWIEAQINNEDLFPTNVGTPFPKNFLQTVRKILSRLFRVFVHVYIHHFDRIAQMGSEAHVNTCYKHFYYFVKEFGLIDTKELEPLKEMTARMCH

• Full Name: MOB1, Mps One Binder kinase activator-like 2A (yeast)
• Calculated Molecular Weight: 217 aa, 25 kDa
• Observed Molecular Weight: 25 kDa
• GenBank Accession Number: BC015049
• Gene Symbol: MOBKL2A
• Gene ID (NCBI): 126308
• RRID: AB_2145383
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96BX8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.