MON1B Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MON1B Polyclonal antibody, PBS Only (17638-1-PBS)

• 

  WB analysis using 17638-1-AP (same clone as 17638-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 17638-1-AP (MON1B antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17638-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 17638-1-AP (same clone as 17638-1-PBS)

  WB result of MON1B antibody (17638-1-AP; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-MON1B transfected HeLa cells. This data was developed using the same antibody clone with 17638-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 17638-1-AP (same clone as 17638-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using MON1B antibody (17638-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 17638-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

MON1B Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 17638-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

17638-1-PBS targets MON1B in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9920

  Product name: Recombinant human MON1B protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 199-547 aa of BC024277

  Sequence: STLTRASVARIFAHKQNYDLRRLLAGSERTLDRLLDSMEQDPGALLLGAVRCVPLARPLRDALGALLRRCTAPGLALSVLAVGGRLITAAQERNVLAECRLDPADLQLLLDWVGAPAFAAGEAWAPVCLPRFNPDGFFYAYVARLDAMPVCLLLLGTQREAFHAMAACRRLVEDGMHALGAMRALGEAASFSNASSASAPAYSVQAVGAPGLRHFLYKPLDIPDHHRQLPQFTSPELEAPYSREEERQRLSDLYHRLHARLHSTSRPLRLIYHVAEKETLLAWVTSKFELYTCLSPLVTKAGAILVVTKLLRWVKKEEDRLFIRYPPKYSTPPATSTDQAAHNGLFTGL

• Full Name: MON1 homolog B (yeast)
• Calculated Molecular Weight: 547 aa, 59 kDa
• Observed Molecular Weight: 59 kDa
• GenBank Accession Number: BC024277
• Gene Symbol: MON1B
• Gene ID (NCBI): 22879
• RRID: AB_2918054
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q7L1V2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Vacuolar fusion protein MON1 homolog B (MON1B) is also named as HSRG1, KIAA0872 and SAND2, and belongs to the MON1/SAND family. The membrane recruitment of MON1B, a homolog of yeast MON1 protein in mammals, is essential for vesicular fusion of early endosomes (PMID:26987402).