MOSC1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MOSC1 Polyclonal antibody, PBS Only (25490-1-PBS)

MOSC1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 25490-1-PBS Copied!

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

EC:1.7.-.-, mARC1, Moco sulfurase C-terminal domain-containing protein 1, Molybdenum cofactor sulfurase C-terminal domain-containing protein 1, MOSC domain-containing protein 1

• 

  WB analysis using 25490-1-AP (same clone as 25490-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 25490-1-AP (MOSC1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25490-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 25490-1-AP (same clone as 25490-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 25490-1-AP (MOSC1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25490-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse kidney using 25490-1-AP (same clone as 25490-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 25490-1-AP (MOSC1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25490-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse lung using 25490-1-AP (same clone as 25490-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 25490-1-AP (MOSC1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25490-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat kidney using 25490-1-AP (same clone as 25490-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 25490-1-AP (MOSC1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25490-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for MOSC1 in ?

Chat with Able

---

Product Information

25490-1-PBS targets MOSC1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21989

  Product name: Recombinant human MOSC1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 117-230 aa of BC010619

  Sequence: LTCDGDTLTLSAAYTKDLLLPIKTPTTNAVHKCRVHGLEIEGRDCGEAAAQWITSFLKSQPYRLVHFEPHKRPRRPHQIADLFRPKDQIAYSDTSPFLILSEASLADLNSRLEK

• Full Name: MOCO sulphurase C-terminal domain containing 1
• Calculated Molecular Weight: 337 aa, 37 kDa
• Observed Molecular Weight: 35-42 kDa
• GenBank Accession Number: BC010619
• Gene Symbol: MOSC1
• Gene ID (NCBI): 64757
• RRID: AB_3669480
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5VT66
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MOSC1 also known as MTARC1 and MARC1. It has 3 isoforms and is mainly expressed in liver, breast and adipose tissue. It is a novel signal-anchored protein of the outer mitochondrial membrane and is active in the N- reductive enzyme system and was also found to contribute to the regulation of nitric oxide synthesis (PMID: 23086957).