MPHOSPH6 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MPHOSPH6 Polyclonal antibody, PBS Only (10695-1-PBS)

• 

  WB analysis of MCF-7 using 10695-1-AP (same clone as 10695-1-PBS)

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 10695-1-AP (MPHOSPH6 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10695-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 10695-1-AP (same clone as 10695-1-PBS)

  MCF7 cells were subjected to SDS PAGE followed by western blot with 10695-1-AP (MPHOSPH6 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10695-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MDA-MB-453s using 10695-1-AP (same clone as 10695-1-PBS)

  MDA-MB-453s cells were subjected to SDS PAGE followed by western blot with 10695-1-AP (MPHOSPH6 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10695-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 10695-1-AP (same clone as 10695-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 10695-1-AP (MPHOSPH6 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10695-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 10695-1-AP (same clone as 10695-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 10695-1-AP (MPHOSPH6 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10695-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 10695-1-AP (same clone as 10695-1-PBS)

  IP result of anti-MPHOSPH6 (IP:10695-1-AP, 4ug; Detection:10695-1-AP 1:500) with HeLa cells lysate 3000 ug. This data was developed using the same antibody clone with 10695-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 10695-1-AP (same clone as 10695-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10695-1-AP (MPHOSPH6 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10695-1-PBS in a different storage buffer formulation.

MPHOSPH6 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 10695-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

M-phase phosphoprotein 6, MPP, MPP 6, MPP6

---

Product Information

10695-1-PBS targets MPHOSPH6 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1080

  Product name: Recombinant human MPHOSPH6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-160 aa of BC005242

  Sequence: MAAERKTKLSKNLLRMKFMQRGLDSETKKQLEEEEKKIISEEHWYLDLPELKEKESFIIEEQSFLLCEDLLYGRMSFRGFNPEVEKLMLQMNAKHKAEEVEDETVELDVSDEEMARRYETLVGTIGKKFARKRDHANYEEDENGDITPIKAKKMFLKPQD

• Full Name: M-phase phosphoprotein 6
• Calculated Molecular Weight: 19 kDa
• Observed Molecular Weight: 19 kDa
• GenBank Accession Number: BC005242
• Gene Symbol: MPHOSPH6
• Gene ID (NCBI): 10200
• RRID: AB_2282161
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q99547
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.