Biotin-conjugated MPO Monoclonal antibody

• 

  IHC staining of human tonsillitis using Biotin-66177

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using Biotin-66177 (MPO antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using Biotin-66177

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using Biotin-66177 (MPO antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

MPO Monoclonal Antibody for IHC, ELISA

Cat No. Biotin-66177

Clone No.4C11F6

Host / Isotype

Mouse / IgA

Reactivity

human

Applications

IHC, ELISA

Synonyms

4C11F6, EC:1.11.2.2, myeloperoxidase

---

Tested Applications

• Positive IHC detected in: human tonsillitis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Not recommend for IHC about rat sample. Mouse monoclonal antibodies of IgA isotype can be detected with "anti-mouse IgG (H+L)" secondary antibodies.

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

Biotin-66177 targets MPO in IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgA
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17564

  Product name: Recombinant human MPO protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 606-657 aa of BC130476

  Sequence: CGLPQPETVGQLGTVLRNLKLARKLMEQYGTPNNIDIWMGGVSEPLKRKGRV

• Full Name: myeloperoxidase
• Calculated Molecular Weight: 745 aa, 84 kDa
• Observed Molecular Weight: 90 kDa
• GenBank Accession Number: BC130476
• Gene Symbol: MPO
• Gene ID (NCBI): 4353
• Conjugate: Biotin
• Excitation/Emission Maxima Wavelengths: -
• Form: Liquid
• Purification Method: Caprylic acid/ammonium sulfate precipitation
• UNIPROT ID: P05164
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

The MPO gene encodes myeloperoxidase, a lysosomal hemoprotein located in the azurophilic granules of polymorphonuclear (PMN) leukocytes and monocytes. In response to stimulation, MPO is activated into a transient intermediate with potent antimicrobial oxidizing abilities(PMID:17650507). The mRNA is translated into a single protein of 90 kDa, which displays enzymatic activity and undergoes proteolytic maturation into a heavy chain of 59 kDa and a light chain of 13.5 kDa; these subunits then dimerize into the mature tetramer and the mature MPO is a heterotetramer composed of two identical heavy chains and two identical light chains(PMID:12773517). Fragments with molecular masses of 43-47 kDa were formed by autocatalysis during warming in sample buffer (PMID:12960244). The 24-kDa material had a map identical to that of 13.5 kDa subunit and represents a dimer of the 13.5 kDa subunit (PMID:3008892). Defects in MPO are the cause of myeloperoxidase deficiency (MPOD). It has 3 isoforms produced by alternative splicing.