Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated MPO Monoclonal antibody

MPO Monoclonal Antibody for IF-P, FC (Intra)

Cat No. CL488-66177
Clone No. 4C11F6
Publications (3)
Reviews (1)
Download datasheet

Host / Isotype

Mouse / IgA

Reactivity

human, rat

Applications

IF-P, FC (Intra)

4C11F6, EC:1.11.2.2, myeloperoxidase

Formulation:  PBS, Proclin300, BSA, Glycerol
PBS, Proclin300, BSA, Glycerol
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for MPO in ?

Tested Applications

Positive IF-P detected inhuman tonsillitis tissue
Positive FC (Intra) detected inHL-60 cells

Not recommend for IHC about rat sample. Mouse monoclonal antibodies of IgA isotype can be detected with "anti-mouse IgG (H+L)" secondary antibodies.

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66177 targets MPO in IF-P, FC (Intra) applications and shows reactivity with human, rat samples.

Tested Reactivity human, rat
Cited Reactivityhuman
Host / Isotype Mouse / IgA
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag17564

Product name: Recombinant human MPO protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 606-657 aa of BC130476

Sequence: CGLPQPETVGQLGTVLRNLKLARKLMEQYGTPNNIDIWMGGVSEPLKRKGRV

Predict reactive species
Full Name myeloperoxidase
Calculated Molecular Weight 745 aa, 84 kDa
Observed Molecular Weight 90 kDa
GenBank Accession NumberBC130476
Gene Symbol MPO
Gene ID (NCBI) 4353
RRIDAB_2919295
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodThiophilic affinity chromatograph
UNIPROT IDP05164
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

The MPO gene encodes myeloperoxidase, a lysosomal hemoprotein located in the azurophilic granules of polymorphonuclear (PMN) leukocytes and monocytes. In response to stimulation, MPO is activated into a transient intermediate with potent antimicrobial oxidizing abilities(PMID:17650507). The mRNA is translated into a single protein of 90 kDa, which displays enzymatic activity and undergoes proteolytic maturation into a heavy chain of 59 kDa and a light chain of 13.5 kDa; these subunits then dimerize into the mature tetramer and the mature MPO is a heterotetramer composed of two identical heavy chains and two identical light chains(PMID:12773517). The 24-kDa material had a map identical to that of 13.5 kDa subunit and represents a dimer of the 13.5 kDa subunit (PMID:3008892). Defects in MPO are the cause of myeloperoxidase deficiency (MPOD). It has 3 isoforms produced by alternative splicing.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 MPO antibody CL488-66177Download protocol
IF protocol for CL Plus 488 MPO antibody CL488-66177Download protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

CL488-66177 is a CoraLite® Plus 488-conjugated MPO monoclonal antibody (clone 4C11F6). It has 3 citations published in Environmental Pollution, Scientific Reports, and Brain Sciences. The research fields span environmental toxicology (nanoplastic-induced NET formation in lupus), neuro-oncology (extracellular vesicles in glioblastoma coagulation and immune modulation), and cerebrovascular biology (microplastic-induced cerebral microcirculatory dysfunction with NET-related markers).

SpeciesApplicationTitle

Environ Pollut

Polystyrene nanoplastics exacerbate systemic lupus erythematosus via neutrophil extracellular traps (NETs) formation.

Authors - Wanlan Jiang
humanIF

Sci Rep

Exploring the dual role of extracellular vesicles in coagulation and immune modulation in glioblastoma.

Authors - Annabell Wolff

Brain Sci

Borneol Alleviates Polyethylene Microsphere-Induced Cerebral Microcirculatory Dysfunction with Reduced NET-Related Markers.

Authors - Yanlong Zhou

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

One customer rated this antibody 5 out of 5 stars, reporting that it worked perfectly in human FFPE tissue (tonsil) at a 1:100 dilution for both IHC and IF applications. The reviewer highlighted very strong fluorescence intensity and excellent performance, confirming reliable results in their experiments.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Sonja (Verified Customer) (08-04-2023)

The antibody works absolutely perfect in human FFPE tissue. The fluorescence intensity was very strong.

  • Applications: Immunohistochemistry, Immunofluorescence
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: FFPE Human Tonsil
CL Plus 488 MPO Antibody Immunohistochemistry,Immunofluorescence validation (1:100 dilution) in FFPE Human Tonsil (Cat no:CL488-66177)
Loading...
||
New chat

Able™

正在加载,请稍候...