Tested Applications
| Positive IF-P detected in | human tonsillitis tissue |
| Positive FC (Intra) detected in | HL-60 cells |
Not recommend for IHC about rat sample. Mouse monoclonal antibodies of IgA isotype can be detected with "anti-mouse IgG (H+L)" secondary antibodies.
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL488-66177 targets MPO in IF-P, FC (Intra) applications and shows reactivity with human, rat samples.
| Tested Reactivity | human, rat |
| Cited Reactivity | human |
| Host / Isotype | Mouse / IgA |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag17564 Product name: Recombinant human MPO protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 606-657 aa of BC130476 Sequence: CGLPQPETVGQLGTVLRNLKLARKLMEQYGTPNNIDIWMGGVSEPLKRKGRV Predict reactive species |
| Full Name | myeloperoxidase |
| Calculated Molecular Weight | 745 aa, 84 kDa |
| Observed Molecular Weight | 90 kDa |
| GenBank Accession Number | BC130476 |
| Gene Symbol | MPO |
| Gene ID (NCBI) | 4353 |
| RRID | AB_2919295 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Excitation Laser | Blue laser (488 nm) |
| Form | Liquid |
| Purification Method | Thiophilic affinity chromatograph |
| UNIPROT ID | P05164 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
The MPO gene encodes myeloperoxidase, a lysosomal hemoprotein located in the azurophilic granules of polymorphonuclear (PMN) leukocytes and monocytes. In response to stimulation, MPO is activated into a transient intermediate with potent antimicrobial oxidizing abilities(PMID:17650507). The mRNA is translated into a single protein of 90 kDa, which displays enzymatic activity and undergoes proteolytic maturation into a heavy chain of 59 kDa and a light chain of 13.5 kDa; these subunits then dimerize into the mature tetramer and the mature MPO is a heterotetramer composed of two identical heavy chains and two identical light chains(PMID:12773517). The 24-kDa material had a map identical to that of 13.5 kDa subunit and represents a dimer of the 13.5 kDa subunit (PMID:3008892). Defects in MPO are the cause of myeloperoxidase deficiency (MPOD). It has 3 isoforms produced by alternative splicing.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for CL Plus 488 MPO antibody CL488-66177 | Download protocol |
| IF protocol for CL Plus 488 MPO antibody CL488-66177 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
CL488-66177 is a CoraLite® Plus 488-conjugated MPO monoclonal antibody (clone 4C11F6). It has 3 citations published in Environmental Pollution, Scientific Reports, and Brain Sciences. The research fields span environmental toxicology (nanoplastic-induced NET formation in lupus), neuro-oncology (extracellular vesicles in glioblastoma coagulation and immune modulation), and cerebrovascular biology (microplastic-induced cerebral microcirculatory dysfunction with NET-related markers).
| Species | Application | Title |
|---|---|---|
Environ Pollut Polystyrene nanoplastics exacerbate systemic lupus erythematosus via neutrophil extracellular traps (NETs) formation. | ||
Sci Rep Exploring the dual role of extracellular vesicles in coagulation and immune modulation in glioblastoma. | ||
Brain Sci Borneol Alleviates Polyethylene Microsphere-Induced Cerebral Microcirculatory Dysfunction with Reduced NET-Related Markers. |
Reviews
What customers say
One customer rated this antibody 5 out of 5 stars, reporting that it worked perfectly in human FFPE tissue (tonsil) at a 1:100 dilution for both IHC and IF applications. The reviewer highlighted very strong fluorescence intensity and excellent performance, confirming reliable results in their experiments.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Sonja (Verified Customer) (08-04-2023) | The antibody works absolutely perfect in human FFPE tissue. The fluorescence intensity was very strong.
 |
