• Featured Product
  • KD/KO Validated

CoraLite®594-conjugated MPO Monoclonal antibody

MPO Monoclonal Antibody for IF-P, FC (Intra)
Cat No. CL594-66177
Clone No.4C11F6

Host / Isotype

Mouse / IgA

Reactivity

human, rat

Applications

IF-P, FC (Intra)

4C11F6, EC:1.11.2.2, myeloperoxidase

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inhuman appendicitis tissue, human liver tissue
Positive FC (Intra) detected inHL-60 cells

Not recommend for IHC about rat sample. Mouse monoclonal antibodies of IgA isotype can be detected with "anti-mouse IgG (H+L)" secondary antibodies.

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

IFSee 1 publications below

Product Information

CL594-66177 targets MPO in IF-P, FC (Intra) applications and shows reactivity with human, rat samples.

Tested Reactivity human, rat
Cited Reactivityhuman
Host / Isotype Mouse / IgA
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag17564

Product name: Recombinant human MPO protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 606-657 aa of BC130476

Sequence: CGLPQPETVGQLGTVLRNLKLARKLMEQYGTPNNIDIWMGGVSEPLKRKGRV

Predict reactive species
Full Name myeloperoxidase
Calculated Molecular Weight 745 aa, 84 kDa
Observed Molecular Weight 90 kDa
GenBank Accession NumberBC130476
Gene Symbol MPO
Gene ID (NCBI) 4353
RRIDAB_2919960
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodThiophilic affinity chromatograph
UNIPROT IDP05164
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

The MPO gene encodes myeloperoxidase, a lysosomal hemoprotein located in the azurophilic granules of polymorphonuclear (PMN) leukocytes and monocytes. In response to stimulation, MPO is activated into a transient intermediate with potent antimicrobial oxidizing abilities(PMID:17650507). The mRNA is translated into a single protein of 90 kDa, which displays enzymatic activity and undergoes proteolytic maturation into a heavy chain of 59 kDa and a light chain of 13.5 kDa; these subunits then dimerize into the mature tetramer and the mature MPO is a heterotetramer composed of two identical heavy chains and two identical light chains(PMID:12773517). The 24-kDa material had a map identical to that of 13.5 kDa subunit and represents a dimer of the 13.5 kDa subunit (PMID:3008892). Defects in MPO are the cause of myeloperoxidase deficiency (MPOD). It has 3 isoforms produced by alternative splicing.

Protocols

Product Specific Protocols
FC protocol for CL594 MPO antibody CL594-66177Download protocol
IF protocol for CL594 MPO antibody CL594-66177Download protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIF

Thromb Haemost

Neutrophil Extracellular Traps: Potential Prothrombotic State Markers and Therapeutic Targets for Atrial Fibrillation

Authors - Xing Liu
Loading...
||
New chat Able
正在加载,请稍候...