CoraLite® Plus 488-conjugated MPO Recombinant monoclonal antibody

• 

  IF Staining of human tonsillitis using CL488-81610

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human tonsillitis tissue using CoraLite® Plus 488 MPO antibody (CL488-81610, Clone: 3J17 ) at dilution of 1:200. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

MPO Uni-rAb^® Recombinant Antibody for IF-P

Cat No. CL488-81610

Clone No.3J17

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF-P

Synonyms

EC:1.11.2.2, myeloperoxidase

---

Tested Applications

• Positive IF-P detected in: human tonsillitis tissue

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-81610 targets MPO in IF-P applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag17564

  Product name: Recombinant human MPO protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 606-657 aa of BC130476

  Sequence: CGLPQPETVGQLGTVLRNLKLARKLMEQYGTPNNIDIWMGGVSEPLKRKGRV

• Full Name: myeloperoxidase
• Calculated Molecular Weight: 745 aa, 84 kDa
• Observed Molecular Weight: 59 kDa, 90 kDa
• GenBank Accession Number: BC130476
• Gene Symbol: MPO
• Gene ID (NCBI): 4353
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P05164
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

The MPO gene encodes myeloperoxidase, a lysosomal hemoprotein located in the azurophilic granules of polymorphonuclear (PMN) leukocytes and monocytes. In response to stimulation, MPO is activated into a transient intermediate with potent antimicrobial oxidizing abilities(PMID:17650507). The mRNA is translated into a single protein of 90 kDa, which displays enzymatic activity and undergoes proteolytic maturation into a heavy chain of 59 kDa and a light chain of 13.5 kDa; these subunits then dimerize into the mature tetramer and the mature MPO is a heterotetramer composed of two identical heavy chains and two identical light chains(PMID:12773517). Fragments with molecular masses of 43-47 kDa were formed by autocatalysis during warming in sample buffer (PMID:12960244).The 24-kDa material had a map identical to that of 13.5 kDa subunit and represents a dimer of the 13.5 kDa subunit (PMID:3008892). Defects in MPO are the cause of myeloperoxidase deficiency (MPOD). It has 3 isoforms produced by alternative splicing.