MPPED1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MPPED1 Polyclonal antibody, PBS Only (13677-1-PBS)

• 

  WB analysis of mouse brain using 13677-1-AP (same clone as 13677-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 13677-1-AP (MPPED1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13677-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat brain using 13677-1-AP (same clone as 13677-1-PBS)

  rat brain tissue were subjected to SDS PAGE followed by western blot with 13677-1-AP (MPPED1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13677-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas using 13677-1-AP (same clone as 13677-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas using 13677-1-AP (MPPED1 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 13677-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas using 13677-1-AP (same clone as 13677-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas using 13677-1-AP (MPPED1 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 13677-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 13677-1-AP (same clone as 13677-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 13677-1-AP (MPPED1 Antibody) at dilution of 1:50(under 10x lens). This data was developed using the same antibody clone with 13677-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 13677-1-AP (same clone as 13677-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 13677-1-AP (MPPED1 Antibody) at dilution of 1:50(under 40x lens). This data was developed using the same antibody clone with 13677-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 13677-1-AP (same clone as 13677-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain using 13677-1-AP (MPPED1 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 13677-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 13677-1-AP (same clone as 13677-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain using 13677-1-AP (MPPED1 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 13677-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 13677-1-AP (same clone as 13677-1-PBS)

  Immunofluorescent analysis of Hela cells, using MPPED1 antibody 13677-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red). This data was developed using the same antibody clone with 13677-1-PBS in a different storage buffer formulation.

MPPED1 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 13677-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

13677-1-PBS targets MPPED1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4672

  Product name: Recombinant human MPPED1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-326 aa of BC028035

  Sequence: MWRSRWDASVLKAEALALLPCGLGMAFSQSHVMAARRHQHSRLIIEVDEYSSNPTQAFTFYNINQGRFQPPHVQMVDPVPHDAPKPPGYTRFVCVSDTHSRTDPIQMPYGDVLIHAGDFTELGLPSEVKKFNEWLGSLPYEYKIVIAGNHELTFDQEFMADLIKQDFYYFPSVSKLKPENYENVQSLLTNCIYLQDSEVTVRGFRIYGSPWQPWFYGWGFNLPRGQALLEKWNLIPEGVDILITHGPPLGFLDWVPKKMQRVGCVELLNTVQRRVQPRLHVFGHIHEGYGVMADGTTTYVNASVCTVNYQPVNPPIVIDLPTPRNS

• Full Name: metallophosphoesterase domain containing 1
• Calculated Molecular Weight: 326 aa, 37 kDa
• Observed Molecular Weight: 37 kDa
• GenBank Accession Number: BC028035
• Gene Symbol: MPPED1
• Gene ID (NCBI): 758
• RRID: AB_10644336
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O15442
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.