MR1 Polyclonal antibody

• 

  WB analysis of THP-1 cells using 13260-1-AP

  WB result of MR1 antibody (13260-1-AP, 1:250) with IP samples of THP.1-MR1 cells, by Claudia Gonzalez-Lopez, MRC Human Immunology Unit, University of Oxford. (Green MR1 protein).

• 

  IF Staining of THP-1 cells using 13260-1-AP

  IF result of MR1 antibody (13260-1-AP, 1:50) with THP.1-MR1 cells, by Claudia Gonzalez-Lopez, MRC Human Immunology Unit, University of Oxford.

• 

  IF Staining of THP-1 using 13260-1-AP

  Immunofluorescent analysis of (4% PFA) fixed THP-1 cells using MR1 antibody (13260-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

MR1 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 13260-1-AP

Publications(7)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

MHC class I-related gene protein, Major histocompatibility complex class I-related gene protein, HLALS, Class I histocompatibility antigen-like protein

---

Tested Applications

• Positive WB detected in: THP-1 cells
• Positive IF/ICC detected in: THP-1 cells

Recommended dilution

• Western Blot (WB): WB : 1:100-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 3 publications below
• IF: See 3 publications below
• FC: See 1 publications below

Product Information

13260-1-AP targets MR1 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3849

  Product name: Recombinant human MR1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 20-260 aa of BC012485

  Sequence: SDSRTHSLRYFRLGVSDPIHGVPEFISVGYVDSHPITTYDSVTRQKEPRAPWMAENLAPDHWERYTQLLRGWQQMFKVELKRLQRHYNHSDNVAHTIKQAWEANQHELLYQKNWLEEECIAWLKRFLEYGKDTLQRTEPPLVRVNRKETFPGVTALFCKAHGFYPPEIYMTWMKNGEEIVQEIDYGDILPSGDGTYQAWASIELDPQSSNLYSCHVEHCGVHMVLQVPQESETIPLVMKAV

• Full Name: major histocompatibility complex, class I-related
• Calculated Molecular Weight: 341 aa, 39 kDa
• GenBank Accession Number: BC012485
• Gene Symbol: MR1
• Gene ID (NCBI): 3140
• RRID: AB_2877930
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q95460
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IF	Proc Natl Acad Sci U S A; Ligand-dependent downregulation of MR1 cell surface expression.; Authors - Mariolina Salio
mouse	IF	Carbohydr Polym; Lepidium meyenii Walpers polysaccharide and its cationic derivative re-educate tumor-associated macrophages for synergistic tumor immunotherapy.; Authors - Tingting Guo
human	WB	J Biol Chem; The P5-type ATPase ATP13A1 modulates major histocompatibility complex I-related protein 1 (MR1)-mediated antigen presentation.; Authors - Corinna A Kulicke
human	FC	Am J Pathol; Bile from Patients with Primary Sclerosing Cholangitis Contains Mucosal-Associated Invariant T-Cell Antigens.; Authors - Laura Valestrand
mouse	IF	Pigment Cell Melanoma Res; Topical antibiotics limit depigmentation in a mouse model of vitiligo; Authors - Ahmed Ahmed Touni
human	WB	Cancer Immunol Res; MR1 gene and protein expression are enhanced by inhibition of the extracellular signal-regulated kinase ERK; Authors - Daniel Constantin

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Tina (Verified Customer) (08-31-2020)

- PAGE was loaded with 80ug total protein - PVDF membrane blocked with milk - first AB dilution 1:250 (stored at -20°C, I could reuse the solution multiple times) - secondary AB I used HRP goat anti-rabbit and a high sensitive ECl to develop the Blot.

• Applications: Western Blot
• Primary Antibody Dilution: 1:250
• Cell Tissue Type: cell lines K562, primary liver cells