Product Information
14213-1-PBS targets MRAS in WB, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5433 Product name: Recombinant human MRAS protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-70 aa of BC047690 Sequence: MATSAVPSDNLPTYKLVVVGDGGVGKSALTIQFFQKIFVPDYDPTIEDSYLKHTEIDNQWAILDVLDTAG Predict reactive species |
| Full Name | muscle RAS oncogene homolog |
| Calculated Molecular Weight | 24 kDa |
| Observed Molecular Weight | 24 kDa |
| GenBank Accession Number | BC047690 |
| Gene Symbol | MRAS |
| Gene ID (NCBI) | 22808 |
| RRID | AB_10950895 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O14807 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |







