MRAS Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MRAS Polyclonal antibody, PBS Only (14213-1-PBS)

• 

  WB analysis using 14213-1-AP (same clone as 14213-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 14213-1-AP (MRAS antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14213-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human brain using 14213-1-AP (same clone as 14213-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 14213-1-AP (MRAS antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14213-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse lung using 14213-1-AP (same clone as 14213-1-PBS)

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 14213-1-AP (MRAS antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14213-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse brain using 14213-1-AP (same clone as 14213-1-PBS)

  IP result of anti-MRAS (IP:14213-1-AP, 4ug; Detection:14213-1-AP 1:800) with mouse brain tissue lysate 2400 ug. This data was developed using the same antibody clone with 14213-1-PBS in a different storage buffer formulation.

MRAS Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 14213-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, Indirect ELISA

Synonyms

---

Product Information

14213-1-PBS targets MRAS in WB, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5433

  Product name: Recombinant human MRAS protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-70 aa of BC047690

  Sequence: MATSAVPSDNLPTYKLVVVGDGGVGKSALTIQFFQKIFVPDYDPTIEDSYLKHTEIDNQWAILDVLDTAG

• Full Name: muscle RAS oncogene homolog
• Calculated Molecular Weight: 24 kDa
• Observed Molecular Weight: 24 kDa
• GenBank Accession Number: BC047690
• Gene Symbol: MRAS
• Gene ID (NCBI): 22808
• RRID: AB_10950895
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O14807
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.