MREG Polyclonal antibody

• 

  WB analysis using 14207-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 14207-1-AP (MREG antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours.

MREG Polyclonal Antibody for WB, ELISA

Cat No. 14207-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

DSU, melanoregulin, MREG, WDT2

---

Tested Applications

• Positive WB detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:5000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14207-1-AP targets MREG in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5416

  Product name: Recombinant human MREG protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-214 aa of BC032747

  Sequence: MGLRDWLRTVCCCCGCECLEERALPEKEPLVSDNNPYSSFGATLVRDDEKNLWSMPHDVSHTEADDDRTLYNLIVIRNQQAKDSEEWQKLNYDIHTLRQVRREVRNRWKCILEDLGFQKEADSLLSVTKLSTISDSKNTRKAREMLLKLAEETNIFPTSWELSERYLFVVDRLIALDAAEEFFKLARRTYPKKPGVPCLADGQKELHYLPFPSP

• Full Name: melanoregulin
• Calculated Molecular Weight: 25kDa
• Observed Molecular Weight: 26 kDa
• GenBank Accession Number: BC032747
• Gene Symbol: MREG
• Gene ID (NCBI): 55686
• RRID: AB_3085432
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N565
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MREG, also known as DSU, belongs to the melanoregulin family. MREG is a small, highly charged protein thought to play a role in organelle biogenesis due to its effect on pigmentation in dilute, ashen, and leaden mutant mice (PMID: 19240024). Additionally, MREG probably functions as a cargo-recognition protein that couples cytoplasmic vesicles to the transport machinery. MREG has 2 isoforms with the molecular weights of 25 and 26 kDa.