MRP3/ABCC3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MRP3/ABCC3 Polyclonal antibody, PBS Only (25358-1-PBS)

• 

  WB analysis using 25358-1-AP (same clone as 25358-1-PBS)

  37°C incubated HeLa cells were subjected to SDS PAGE followed by western blot with 25358-1-AP (MRP3/ABCC3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25358-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 25358-1-AP (same clone as 25358-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 25358-1-AP (MRP3/ABCC3 antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25358-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 25358-1-AP (same clone as 25358-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 25358-1-AP (MRP3/ABCC3 antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25358-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 25358-1-AP (same clone as 25358-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 25358-1-AP (MRP3/ABCC3 antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25358-1-PBS in a different storage buffer formulation.

MRP3/ABCC3 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 25358-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

ABCC3, MRP3, ABC31, ATP-binding cassette sub-family C member 3, EC:7.6.2.-

---

Product Information

25358-1-PBS targets MRP3/ABCC3 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19786

  Product name: Recombinant human ABCC3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 838-960 aa of BC137348

  Sequence: LLQRNGSFANFLCNYAPDEDQGHLEDSWTALEGAEDKEALLIEDTLSNHTDLTDNDPVTYVVQKQFMRQLSALSSDGEGQGRPVPRRHLGPSEKVQVTEAKADGALTQEEKAAIGTVELSVFW

• Full Name: ATP-binding cassette, sub-family C (CFTR/MRP), member 3
• Calculated Molecular Weight: 1527 aa, 169 kDa
• Observed Molecular Weight: 170-180 kDa
• GenBank Accession Number: BC137348
• Gene Symbol: MRP3
• Gene ID (NCBI): 8714
• RRID: AB_3085789
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O15438
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MRP3 also known as ABCC3, belongs to ATP-binding cassette (ABC) transporter protein superfamily. MRP3 hydrolyzes ATP to enable active transport of various substrates including many drugs, toxicants, and endogenous compounds across cell membranes (PMID: 11581266, 15083066). In normal liver, MRP3 was found present mainly in the bile ducts. In livers of patients with various forms of cholestasis, MRP3 levels were frequently increased in the proliferative cholangiocytes, suggesting its role in cholehepatic and enterohepatic bile circulation and in protecting liver from toxic bile salts( PMID: 11850532, 11283840). MRP3 is expressed in the liver, colon, pancreas, and, at a lower level, in the kidney (PMID:10094960). For optimal WB detection of this membrane protein, we recommend to avoid boiling the sample after lysis.