Product Information
25358-1-PBS targets MRP3/ABCC3 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag19786 Product name: Recombinant human ABCC3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 838-960 aa of BC137348 Sequence: LLQRNGSFANFLCNYAPDEDQGHLEDSWTALEGAEDKEALLIEDTLSNHTDLTDNDPVTYVVQKQFMRQLSALSSDGEGQGRPVPRRHLGPSEKVQVTEAKADGALTQEEKAAIGTVELSVFW Predict reactive species |
| Full Name | ATP-binding cassette, sub-family C (CFTR/MRP), member 3 |
| Calculated Molecular Weight | 1527 aa, 169 kDa |
| Observed Molecular Weight | 170-180 kDa |
| GenBank Accession Number | BC137348 |
| Gene Symbol | MRP3 |
| Gene ID (NCBI) | 8714 |
| RRID | AB_3085789 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O15438 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
MRP3 also known as ABCC3, belongs to ATP-binding cassette (ABC) transporter protein superfamily. MRP3 hydrolyzes ATP to enable active transport of various substrates including many drugs, toxicants, and endogenous compounds across cell membranes (PMID: 11581266, 15083066). In normal liver, MRP3 was found present mainly in the bile ducts. In livers of patients with various forms of cholestasis, MRP3 levels were frequently increased in the proliferative cholangiocytes, suggesting its role in cholehepatic and enterohepatic bile circulation and in protecting liver from toxic bile salts( PMID: 11850532, 11283840). MRP3 is expressed in the liver, colon, pancreas, and, at a lower level, in the kidney (PMID:10094960). For optimal WB detection of this membrane protein, we recommend to avoid boiling the sample after lysis.







