MRPL4 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• MRPL4 Polyclonal antibody (27484-1-AP)

• Featured Product
• KD/KO Validated

MRPL4 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 27484-1-AP Copied!

Publications (9)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

MRP L4, Large ribosomal subunit protein uL4m, L4mt, CGI-28, CGI 28

• 

  WB analysis of HL-60 using 27484-1-AP

  HL-60 cells were subjected to SDS PAGE followed by western blot with 27484-1-AP (MRPL4 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 27484-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 27484-1-AP (MRPL4 antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 27484-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 27484-1-AP (MRPL4 antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 27484-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using MRPL4 antibody (27484-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for MRPL4 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HL-60 cells
• Positive IHC detected in: human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:10000-1:40000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27484-1-AP targets MRPL4 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26568

  Product name: Recombinant human MRPL4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 22-154 aa of BC000756

  Sequence: SSLAEEAARATENPEQVASEGLPEPVLRKVELPVPTHRRPVQAWVESLRGFEQERVGLADLHPDVFATAPRLDILHQVAMWQKNFKRISYAKTKTRAEVRGGGRKPWPQKGTGRARHGSIRSPLWRGGGVAHG

• Full Name: mitochondrial ribosomal protein L4
• Calculated Molecular Weight: 35 kDa
• Observed Molecular Weight: 36 kDa
• GenBank Accession Number: BC000756
• Gene Symbol: MRPL4
• Gene ID (NCBI): 51073
• RRID: AB_2810294
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BYD3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

MRPL4 Polyclonal antibody (Cat# 27484-1-AP) has 9 citations published in Nature Metabolism, Nucleic Acids Research, Advanced Science, Nature Structural & Molecular Biology, PNAS, EMBO Reports, Scientific Reports, Frontiers in Oncology, and bioRxiv. Research fields span mitochondrial disease, mitoribosome assembly and quality control, organelle transcriptomics, aging-related T cell dysfunction, and cancers including pancreatic, gastric, and colorectal.

Automatically generated from the 9 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Metab; Tetracyclines promote survival and fitness in mitochondrial disease models.; Authors - Elizabeth A Perry ; KO Validated
human	WB	Nucleic Acids Res; CoLoC-seq probes the global topology of organelle transcriptomes; Authors - Damien Jeandard
human	WB	Adv Sci (Weinh); Cancer-Associated Fibroblast-Derived Sphingosine-1-Phosphate Activates a MALL-SDC4 Axis to Facilitate Perineural Invasion in Pancreatic Cancer; Authors - Wang Peng
human	WB	Nat Struct Mol Biol; A roadmap for ribosome assembly in human mitochondria; Authors - Elena Lavdovskaia
human	WB	Proc Natl Acad Sci U S A; Cryoelectron tomography reveals an age-related decline in mitoribosomes that contributes to T cell dysfunction in older individuals; Authors - Jingwen Chen
human	WB	EMBO Rep; Tetracyclines activate mitoribosome quality control and reduce ER stress to promote cell survival; Authors - Conor T Ronayne