MRPL42 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• MRPL42 Polyclonal antibody (17300-1-AP)

MRPL42 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 17300-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA
For FC, select conjugated version.

Synonyms

HSPC204, L31mt, L42mt, ML42, MRP L31

• 

  WB analysis using 17300-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 17300-1-AP (MRPL42 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 17300-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 17300-1-AP (MRPL42 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 17300-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 17300-1-AP (MRPL42 antibody) at dilution of 1:1000 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 17300-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 17300-1-AP (MRPL42 antibody) at dilution of 1:1000 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 17300-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using MRPL42 antibody (17300-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for MRPL42 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, RAW 264.7 cells, HepG2 cells, MCF-7 cells, Jurkat cells, PC-3 cells, HSC-T6 cells
• Positive IHC detected in: human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

17300-1-AP targets MRPL42 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11181

  Product name: Recombinant human MRPL42 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-142 aa of BC040240

  Sequence: MAVAAVKWVMSKRTILKHLFPVQNGALYCVCHKSTYSPLPDDYNCNVELALTSDGRTIVCYHPSVDIPYEHTKPIPRPDPVHNNEETHDQVLKTRLEEKVEHLEEGPMIEQLSKMFFTTKHRWYPHGRYHRCRKNLNPPKDR

• Full Name: mitochondrial ribosomal protein L42
• Calculated Molecular Weight: 142 aa, 17 kDa
• Observed Molecular Weight: 14-17 kDa
• GenBank Accession Number: BC040240
• Gene Symbol: MRPL42
• Gene ID (NCBI): 28977
• RRID: AB_2935442
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y6G3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The MRPL42 Polyclonal antibody (Cat# 17300-1-AP) has 1 citation. It was used in a study published in NPJ Genomic Medicine (2026), which investigated a biallelic MRPL42 variant causing combined oxidative phosphorylation deficiency syndrome through multi-omics analysis. The antibody was applied in Western Blot and Immunofluorescence on human samples. The research falls within the fields of mitochondrial genetics, oxidative phosphorylation disorders, and genomic medicine.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IF	NPJ Genom Med; A biallelic MRPL42 variant causes a combined oxidative phosphorylation deficiency syndrome revealed by multi-omics.; Authors - Felix Boschann