MRPL51 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 83565-1-RR (same clone as 83565-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83565-1-RR (MRPL51 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83565-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 83565-1-RR (same clone as 83565-1-PBS)

  WB result of MRPL51 antibody (83565-1-RR; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-MRPL51 transfected HEK-293 cells. This data was developed using the same antibody clone with 83565-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 83565-1-RR (same clone as 83565-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 83565-1-RR (MRPL51 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83565-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 83565-1-RR (same clone as 83565-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 83565-1-RR (MRPL51 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83565-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovarian cancer using 83565-1-RR (same clone as 83565-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovarian cancer slide using 83565-1-RR (MRPL51 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83565-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HEK-293 using 83565-1-RR (same clone as 83565-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HEK-293 cells using MRPL51 antibody (83565-1-RR, Clone: 240381C3 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 83565-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83565-1-RR

  Biolayer interferometry (BLl) kinetic assays of 83565-1-RR against Human MRPL51 were performed. The affinity constant is 0.57 nM.

• Featured Product
• KD/KO Validated

MRPL51 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 83565-1-PBS

Clone No.240381C3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

240381C3, bMRP 64, bMRP64, bMRP-64, CDA09

---

Product Information

83565-1-PBS targets MRPL51 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag7193

  Product name: Recombinant human MRPL51 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-128 aa of BC000191

  Sequence: MAGNLLSGAGRRLWDWVPLACRSFSLGVPRLIGIRLTLPPPKVVDRWNEKRAMFGVYDNIGILGNFEKHPKELIRGPIWLRGWKGNELQRCIRKRKMVGSRMFADDLHNLNKRIRYLYKHFNRHGKFR

• Full Name: mitochondrial ribosomal protein L51
• Calculated Molecular Weight: 15 kDa
• Observed Molecular Weight: 12 kDa
• GenBank Accession Number: BC000191
• Gene Symbol: MRPL51
• Gene ID (NCBI): 51258
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q4U2R6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Mitochondrial ribosome protein L51 (MRPL51) is a 39S subunit protein of the mitochondrial ribosome. MRPL51 functions in the translation of genetic messages (PMID: 21730110). MRPL51 expression was positively correlated with cell cycle, DNA damage, DNA repair, epithelial-mesenchymal transition, invasion, and proliferation of LUAD cells at the single cell level (PMID: 37323822). The calculated molecular weight of MRPL51 is 15 kDa.