MRPS12 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MRPS12 Polyclonal antibody, PBS Only (15225-1-PBS)

• 

  WB analysis using 15225-1-AP (same clone as 15225-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 15225-1-AP (MRPS12 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15225-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 15225-1-AP (same clone as 15225-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 15225-1-AP (MRPS12 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15225-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 15225-1-AP (same clone as 15225-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 15225-1-AP (MRPS12 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15225-1-PBS in a different storage buffer formulation.

MRPS12 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 15225-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

MRP-S12, MT-RPS12, RPMS12, RPS12, RPSM12

---

Product Information

15225-1-PBS targets MRPS12 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7442

  Product name: Recombinant human MRPS12 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-138 aa of BC001617

  Sequence: MSWSGLLHGLNTSLTCGPALVPRLWATCSMATLNQMHRLGPPKRPPRKLGPTEGRPQLKGVVLCTFTRKPKKPNSANRKCCRVRLSTGREAVCFIPGEGHTLQEHQIVLVEGGRTQDLPGVKLTVVRGKYDCGHVQKK

• Full Name: mitochondrial ribosomal protein S12
• Calculated Molecular Weight: 15 kDa
• Observed Molecular Weight: 13-15 kDa
• GenBank Accession Number: BC001617
• Gene Symbol: MRPS12
• Gene ID (NCBI): 6183
• RRID: AB_10597843
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O15235
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.