MRPS16 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• MRPS16 Polyclonal antibody (16735-1-AP)

• Featured Product
• KD/KO Validated

MRPS16 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 16735-1-AP Copied!

Publications (22)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

CGI 132, CGI132, CGI-132, COXPD2, MRP S16

• 

  WB analysis using 16735-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16735-1-AP (MRPS16 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 16735-1-AP

  WB result of MRPS16 antibody (16735-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-MRPS16 transfected HeLa cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HEK-293 using 16735-1-AP

  IP result of anti-MRPS16 (IP:16735-1-AP, 4ug; Detection:16735-1-AP 1:500) with HEK-293 cells lysate 1480ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 16735-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 16735-1-AP (MRPS16 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 16735-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using MRPS16 antibody (16735-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for MRPS16 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HeLa cells, Jurkat cells, HepG2 cells, mouse liver tissue, rat liver tissue
• Positive IP detected in: HEK-293 cells
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16735-1-AP targets MRPS16 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9749

  Product name: Recombinant human MRPS16 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-137 aa of BC021106

  Sequence: MVHLTTLLCKAYRGGHLTIRLALGGCTNRPFYRIVAAHNKCPRDGRFVEQLGSYDPLPNSHGEKLVALNLDRIRHWIGCGAHLSKPMEKLLGLAGFFPLHPMMITNAERLRRKRAREVLLASQKTDAEATDTEATET

• Full Name: mitochondrial ribosomal protein S16
• Calculated Molecular Weight: 137 aa, 15 kDa
• Observed Molecular Weight: 15 kDa
• GenBank Accession Number: BC021106
• Gene Symbol: MRPS16
• Gene ID (NCBI): 51021
• RRID: AB_2180166
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y3D3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The MRPS16 Polyclonal antibody (Cat# 16735-1-AP) has 22 citations. These appear in journals including Nature Communications, Nucleic Acids Research, Science Advances, Nature Structural & Molecular Biology, EMBO Journal, Cell Reports, Aging Cell, American Journal of Human Genetics, EMBO Reports, Journal of Cell Science, PLoS Genetics, Human Molecular Genetics, eLife, and bioRxiv. The research fields center on mitochondrial biology—mitoribosome assembly, mitochondrial translation, and respiratory complex biogenesis—along with mitochondrial disease, metabolic stress, and cardiovascular and liver cancer studies.

Automatically generated from the 22 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Nat Commun; Loss of the RNA-binding protein TACO1 causes late-onset mitochondrial dysfunction in mice.; Authors - Tara R Richman
human	WB	Nat Commun; TANGO2 binds crystallin alpha B and its loss causes desminopathy; Authors - Maike Stentenbach
human	WB	Nucleic Acids Res; The human Obg protein GTPBP10 is involved in mitoribosomal biogenesis.; Authors - Elena Lavdovskaia
mouse	WB	Nucleic Acids Res; WBSCR16 is essential for mitochondrial 16S rRNA processing in mammals; Authors - Shengjie Zhang
mouse	WB	Sci Adv; Adult-onset obesity is triggered by impaired mitochondrial gene expression.; Authors - Kara L Perks
mouse	WB	Sci Adv; Fidelity of translation initiation is required for coordinated respiratory complex assembly.; Authors - Danielle L Rudler