Filter: AllIHCIF/ICC

IHC staining of human pancreas using 16359-1-AP (same clone as 16359-1-PBS)
Immunohistochemical analysis of paraffin-embedded human pancreas tissue slide using 16359-1-AP (MRPS21 antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 16359-1-PBS in a different storage buffer formulation.
IHC staining of human pancreas using 16359-1-AP (same clone as 16359-1-PBS)
Immunohistochemical analysis of paraffin-embedded human pancreas tissue slide using 16359-1-AP (MRPS21 antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 16359-1-PBS in a different storage buffer formulation.
IF Staining of HepG2 using 16359-1-AP (same clone as 16359-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using MRPS21 antibody (16359-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 16359-1-PBS in a different storage buffer formulation.

MRPS21 Polyclonal antibody, PBS Only

Name: MRPS21 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 16359-1-PBS

MRPS21 Polyclonal Antibody for IHC, IF/ICC, Indirect ELISA

Cat No. 16359-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, IF/ICC, Indirect ELISA

Synonyms

Small ribosomal subunit protein bS21m, S21mt, RPMS21, MRP-S21, MRP S21

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

Freight/Packing: -

Quantity

- +

16359-1-PBS targets MRPS21 in IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag8343 Product name: Recombinant human MRPS21 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-87 aa of BC004566 Sequence: MAKHLKFIARTVMVQEGNVESAYRTLNRILTMDGLIEDIKHRRYYEKPCRRRQRESYERCRRIYNMEMARKINFLMRKNRADPWQGC Predict reactive species
Full Name	mitochondrial ribosomal protein S21
Calculated Molecular Weight	87 aa, 11 kDa
GenBank Accession Number	BC004566
Gene Symbol	MRPS21
Gene ID (NCBI)	54460
RRID	AB_2180349
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P82921
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Able™