MRPS25 Monoclonal antibody

• 

  WB analysis using 67903-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67903-1-Ig (MRPS25 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control.

• 

  WB analysis using 67903-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67903-1-Ig (MRPS25 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 67903-1-Ig

  WB result of MRPS25 antibody (67903-1-Ig; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-MRPS25 transfected HepG2 cells.

• Featured Product
• KD/KO Validated

MRPS25 Monoclonal Antibody for WB, ELISA

Cat No. 67903-1-Ig

Clone No.3B10B6

Publications(1)

Host / Isotype

Mouse / IgG2b

Reactivity

Human, mouse, rat and More (1)

Applications

WB, ELISA

Synonyms

DKFZp313H0817, FLJ00023, MRP S25, MRPS25, RPMS25, S25mt

---

Tested Applications

• Positive WB detected in: HeLa cells, NIH/3T3 cells, HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells, PC-12 cells, 4T1 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

67903-1-Ig targets MRPS25 in WB, ELISA applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7846

  Product name: Recombinant human MRPS25 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-173 aa of BC003590

  Sequence: MPMKGRFPIRRTLQYLSQGNVVFKDSVKVMTVNYNTHGELGEGARKFVFFNIPQIQYKNPWVQIMMFKNMTPSPFLRFYLDSGEQVLVDVETKSNKEIMEHIRKILGKNEETLREEEEEKKQLSHPANFGPRKYCLRECICEVEGQVPCPSLVPLPKEMRGKYKAALKADAQD

• Full Name: mitochondrial ribosomal protein S25
• Calculated Molecular Weight: 20 kDa
• Observed Molecular Weight: 20 kDa
• GenBank Accession Number: BC003590
• Gene Symbol: MRPS25
• Gene ID (NCBI): 64432
• RRID: AB_2918659
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P82663
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Mitochondrial ribosomal protein S25 (MRPS25) belongs to the ribosomal protein S25/L51 family. It is a component of the mitochondrial ribosome small subunit (28S). The variant segregated with the disease and substitutes a highly conserved proline residue with leucine (p.P72L) that, based on the high-resolution structure of the 28S ribosome, is predicted to compromise inter-protein contacts and destabilize the small subunit.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell Rep; A microscopy-based screen identifies cellular kinases modulating mitochondrial translation; Authors - Roya Yousefi