• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated MRPS25 Monoclonal antibody

MRPS25 Monoclonal Antibody for
Cat No. CL488-67903
Clone No.3B10B6

Host / Isotype

Mouse / IgG2b

Reactivity

Human, mouse, rat

Applications

DKFZp313H0817, FLJ00023, MRP S25, MRPS25, RPMS25, S25mt

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

CL488-67903 targets MRPS25 in applications and shows reactivity with Human, mouse, rat samples.

Tested Reactivity Human, mouse, rat
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag7846

Product name: Recombinant human MRPS25 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-173 aa of BC003590

Sequence: MPMKGRFPIRRTLQYLSQGNVVFKDSVKVMTVNYNTHGELGEGARKFVFFNIPQIQYKNPWVQIMMFKNMTPSPFLRFYLDSGEQVLVDVETKSNKEIMEHIRKILGKNEETLREEEEEKKQLSHPANFGPRKYCLRECICEVEGQVPCPSLVPLPKEMRGKYKAALKADAQD

Predict reactive species
Full Name mitochondrial ribosomal protein S25
Calculated Molecular Weight 20 kDa
Observed Molecular Weight20 kDa
GenBank Accession NumberBC003590
Gene Symbol MRPS25
Gene ID (NCBI) 64432
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP82663
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Mitochondrial ribosomal protein S25 (MRPS25) belongs to the ribosomal protein S25/L51 family. It is a component of the mitochondrial ribosome small subunit (28S). The variant segregated with the disease and substitutes a highly conserved proline residue with leucine (p.P72L) that, based on the high-resolution structure of the 28S ribosome, is predicted to compromise inter-protein contacts and destabilize the small subunit.

Loading...
||
New chat Able
正在加载,请稍候...