Product Information
17162-1-PBS targets MRPS33 in WB, IF-P, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag10566 Product name: Recombinant human MRPS33 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 2-106 aa of BC015462 Sequence: SSLSEYAFRMSRLSARLFGEVTRPTNSKSMKVVKLFSELPLAKKKETYDWYPNHHTYAELMQTLRFLGLYRDEHQDFMDEQKRLKKLRGKEKPKKGEGKRAAKRK Predict reactive species |
| Full Name | mitochondrial ribosomal protein S33 |
| Calculated Molecular Weight | 106 aa, 13 kDa |
| Observed Molecular Weight | 13-15 kDa |
| GenBank Accession Number | BC015462 |
| Gene Symbol | MRPS33 |
| Gene ID (NCBI) | 51650 |
| RRID | AB_3741908 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9Y291 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
MRPS33 (mitochondrial ribosomal protein S33), also known as small ribosomal subunit protein mS33, is a nuclear-encoded mitochondrial protein that serves as a structural constituent of the small (28S) subunit of the mitochondrial ribosome.



