MS4A12 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MS4A12 Polyclonal antibody, PBS Only (13293-1-PBS)

• 

  WB analysis using 13293-1-AP (same clone as 13293-1-PBS)

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 13293-1-AP (MS4A12 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13293-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 13293-1-AP (same clone as 13293-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 13293-1-AP (MS4A12 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13293-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 13293-1-AP (same clone as 13293-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 13293-1-AP (MS4A12 Antibody) at dilution of 1:50. This data was developed using the same antibody clone with 13293-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 13293-1-AP (same clone as 13293-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 13293-1-AP (MS4A12 Antibody) at dilution of 1:50. This data was developed using the same antibody clone with 13293-1-PBS in a different storage buffer formulation.

MS4A12 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 13293-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

13293-1-PBS targets MS4A12 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3968

  Product name: Recombinant human MS4A12 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-100 aa of BC029793

  Sequence: MMSSKPTSHAEVNETIPNPYPPSSFMAPGFQQPLGSINLENQAQGAQRAQPYGITSPGIFASSQPGQGNIQMINPSVGTAVMNFKEEAKALGVIQIMVGL

• Full Name: membrane-spanning 4-domains, subfamily A, member 12
• Calculated Molecular Weight: 267 aa, 28 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: BC029793
• Gene Symbol: MS4A12
• Gene ID (NCBI): 54860
• RRID: AB_10596915
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NXJ0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.