Product Information
26808-1-PBS targets MS4A2 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25196 Product name: Recombinant human MS4A2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-92 aa of BC074843 Sequence: MDTESNRRANLALPQEPSSVPAFEVLEISPQEVSSGRLLKSASSPPLHTWLTVLKKEQEFLGVTQILTAMICLCFGTVVCSVLDISHIEGDI Predict reactive species |
| Full Name | membrane-spanning 4-domains, subfamily A, member 2 (Fc fragment of IgE, high affinity I, receptor for; beta polypeptide) |
| Calculated Molecular Weight | 244 aa, 27 kDa |
| Observed Molecular Weight | 25-27 kDa |
| GenBank Accession Number | BC074843 |
| Gene Symbol | MS4A2 |
| Gene ID (NCBI) | 2206 |
| RRID | AB_3085906 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q01362 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
MS4A is a new gene family with four transmembrane-spanning domains and is crucial for cell differentiation, signaling, and cell cycle control. The membrane-spanning 4 domains, superfamily A, number 2 gene (MS4A2, also named as the beta-chain of the high affinity IgE receptor or FcεRIβ gene, FCER1B), as a member of the MS4A family, is a component of the high-affinity IgE receptor, with co-immunoprecipitation experiments demonstrating that it associates with FcɛRIα and FcRγ to form a tetrameric receptor complex (αβγ2) that is expressed on mast cells and basophils at high density(PMID: 25835430). MS4A2 is strongly associated with the prognosis of lung adenocarcinoma and lung cancer brain metastases(PMID: 37533433).
