MSH6 Monoclonal antibody

MSH6 Monoclonal Antibody for IHC, ELISA

Cat No. 66172-2-Ig

Clone No. 5B5A7

Review Product

Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

IHC, ELISA

Synonyms

5B5A7, G/T mismatch binding protein, G/T mismatch-binding protein, GTBP, GTMBP

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllIHC-AutostainerIHC

IHC staining of human appendicitis using 66172-2-Ig
Immunohistochemical analysis of paraffin-embedded human appendicitis tissue slide using 66172-2-Ig (MSH6 antibody) at dilution of 1:5000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). The staining was performed on an autostainer.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human tonsillitis using 66172-2-Ig
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66172-2-Ig (MSH6 antibody) at dilution of 1:5000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). The staining was performed on an autostainer.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human ovary cancer using 66172-2-Ig
Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 66172-2-Ig (MSH6 antibody) at dilution of 1:5000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). The staining was performed on an autostainer.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human colorectal cancer using 66172-2-Ig
Immunohistochemical analysis of paraffin-embedded human colorectal cancer tissue slide using 66172-2-Ig (MSH6 antibody) at dilution of 1:5000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). The staining was performed on an autostainer.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human stomach cancer using 66172-2-Ig
Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 66172-2-Ig (MSH6 antibody) at dilution of 1:5000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). The staining was performed on an autostainer.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human stomach cancer using 66172-2-Ig
Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 66172-2-Ig (MSH6 antibody) at dilution of 1:5000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). The staining was performed on an autostainer.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human stomach cancer using 66172-2-Ig
Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 66172-2-Ig (MSH6 antibody) at dilution of 1:5000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). The staining was performed on an autostainer.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human tonsillitis using 66172-2-Ig
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66172-2-Ig (MSH6 antibody) at dilution of 1:10000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human colon cancer using 66172-2-Ig
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66172-2-Ig (MSH6 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human colon using 66172-2-Ig
Immunohistochemical analysis of paraffin-embedded human normal colon slide using 66172-2-Ig (MSH6 antibody) at dilution of 1:4000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human appendicitis using 66172-2-Ig
Immunohistochemical analysis of paraffin-embedded human appendicitis tissue slide using 66172-2-Ig (MSH6 antibody) at dilution of 1:10000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human rectal cancer using 66172-2-Ig
Immunohistochemical analysis of paraffin-embedded human rectal cancer tissue slide using 66172-2-Ig (MSH6 antibody) at dilution of 1:10000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human colon cancer using 66172-2-Ig
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66172-2-Ig (MSH6 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human colorectal cancer using 66172-2-Ig
Immunohistochemical analysis of paraffin-embedded human colorectal cancer tissue slide using 66172-2-Ig (MSH6 antibody) at dilution of 1:5000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human colorectal cancer using 66172-2-Ig
Immunohistochemical analysis of paraffin-embedded human colorectal cancer tissue slide using 66172-2-Ig (MSH6 antibody) at dilution of 1:5000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human stomach cancer using 66172-2-Ig
Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 66172-2-Ig (MSH6 antibody) at dilution of 1:5000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human ovary cancer using 66172-2-Ig
Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 66172-2-Ig (MSH6 antibody) at dilution of 1:5000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human stomach cancer using 66172-2-Ig
Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 66172-2-Ig (MSH6 antibody) at dilution of 1:5000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human stomach cancer using 66172-2-Ig
Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 66172-2-Ig (MSH6 antibody) at dilution of 1:5000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human appendicitis using 66172-2-Ig
Immunohistochemical analysis of paraffin-embedded human appendicitis tissue slide using 66172-2-Ig (MSH6 antibody) at dilution of 1:5000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human tonsillitis using 66172-2-Ig
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66172-2-Ig (MSH6 antibody) at dilution of 1:5000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human tonsillitis using 66172-2-Ig
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66172-2-Ig (MSH6 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human tonsillitis using 66172-2-Ig
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66172-2-Ig (MSH6 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for MSH6 in ?

Overview

Tested Applications
Product Information
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive IHC-Autostainer detected in	human tonsillitis tissue, human stomach cancer tissue, human colorectal cancer tissue, human ovary cancer tissue, human appendicitis tissue
Positive IHC detected in	human tonsillitis tissue, human colon tissue, human colorectal cancer tissue, human colon cancer tissue, human ovary cancer tissue, human stomach cancer tissue, human rectal cancer tissue, human tonsillitis tissue, human appendicitis tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***

Recommended dilution

Application	Dilution
Immunohistochemistry (IHC)-AUTOSTAINER	IHC-AUTOSTAINER : 1:2500-1:10000
Immunohistochemistry (IHC)	IHC : 1:5000-1:20000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66172-2-Ig targets MSH6 in IHC, ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Host / Isotype	Mouse / IgG1
Class	Monoclonal
Type	Antibody
Immunogen	CatNo: Ag12645 Product name: Recombinant human MSH6 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-400 aa of BC004246 Sequence: MSRQSTLYSFFPKSPALSDANKASARASREGGRAAAAPGASPSPGGDAAWSEAGPGPRPLARSASPPKAKNLNGGLRRSVAPAAPTSCDFSPGDLVWAKMEGYPWWPCLVYNHPFDGTFIREKGKSVRVHVQFFDDSPTRGWVSKRLLKPYTGSKSKEAQKGGHFYSAKPEILRAMQRADEALNKDKIKRLELAVCDEPSEPEEEEEMEVGTTYVTDKSEEDNEIESEEEVQPKTQGSRRSSRQIKKRRVISDSESDIGGSDVEFKPDTKEEGSSDEISSGVGDSESEGLNSPVKVARKRKRMVTGNGSLKRKSSRKETPSATKQATSISSETKNTLRAFSAPQNSESQAHVSGGGDDSSRPTVWYHETLEWLKEEKRRDEHRRRPDHPDFDASTLYVPE Predict reactive species
Full Name	mutS homolog 6 (E. coli)
Calculated Molecular Weight	153 kDa
Observed Molecular Weight	150-160 kDa
GenBank Accession Number	BC004246
Gene Symbol	MSH6
Gene ID (NCBI)	2956
RRID	AB_3743303
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein G purification
UNIPROT ID	P52701
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MSH6, also named as DNA mismatch repair protein Msh6 or GTMBP, is a 1360 amino acid protein, which contains one PWWP domain and belongs to the DNA mismatch repair MutS family. MSH6 localizes in the nucleus and is a component of the post-replicative DNA mismatch repair system. Msh2 and Msh6 form a protein complex required to repair mismatches generated during DNA replication.