MSH6 Monoclonal antibody, PBS Only (Capture)

MSH6 Monoclonal Antibody for IHC, Cytometric bead array, Indirect ELISA
Cat No. 66172-2-PBS
Clone No.5B5A7

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

IHC, Cytometric bead array, Indirect ELISA

5B5A7, G/T mismatch binding protein, G/T mismatch-binding protein, GTBP, GTMBP

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66172-2-PBS targets MSH6 as part of a matched antibody pair:

MP50291-1: 66172-2-PBS capture and 66172-3-PBS detection (validated in Cytometric bead array)

MP50291-2: 66172-2-PBS capture and 66172-4-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag12645

Product name: Recombinant human MSH6 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-400 aa of BC004246

Sequence: MSRQSTLYSFFPKSPALSDANKASARASREGGRAAAAPGASPSPGGDAAWSEAGPGPRPLARSASPPKAKNLNGGLRRSVAPAAPTSCDFSPGDLVWAKMEGYPWWPCLVYNHPFDGTFIREKGKSVRVHVQFFDDSPTRGWVSKRLLKPYTGSKSKEAQKGGHFYSAKPEILRAMQRADEALNKDKIKRLELAVCDEPSEPEEEEEMEVGTTYVTDKSEEDNEIESEEEVQPKTQGSRRSSRQIKKRRVISDSESDIGGSDVEFKPDTKEEGSSDEISSGVGDSESEGLNSPVKVARKRKRMVTGNGSLKRKSSRKETPSATKQATSISSETKNTLRAFSAPQNSESQAHVSGGGDDSSRPTVWYHETLEWLKEEKRRDEHRRRPDHPDFDASTLYVPE

Predict reactive species
Full Name mutS homolog 6 (E. coli)
Calculated Molecular Weight 153 kDa
Observed Molecular Weight150-160 kDa
GenBank Accession NumberBC004246
Gene Symbol MSH6
Gene ID (NCBI) 2956
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP52701
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

MSH6, also named as DNA mismatch repair protein Msh6 or GTMBP, is a 1360 amino acid protein, which contains one PWWP domain and belongs to the DNA mismatch repair MutS family. MSH6 localizes in the nucleus and is a component of the post-replicative DNA mismatch repair system. Msh2 and Msh6 form a protein complex required to repair mismatches generated during DNA replication.

Loading...
||
New chat

Able

正在加载,请稍候...