MSH6 Monoclonal antibody, PBS Only (Capture)

• Home
• Products
• Primary Antibodies
• MSH6 Monoclonal antibody, PBS Only (Capture) (66172-2-PBS)

MSH6 Monoclonal Antibody for IHC, Cytometric bead array, Indirect ELISA

Cat No. 66172-2-PBS Copied!

Clone No. 5B5A7

Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

IHC, Cytometric bead array, Indirect ELISA

Synonyms

5B5A7, G/T mismatch binding protein, G/T mismatch-binding protein, GTBP, GTMBP

• 

  IHC staining of human appendicitis using 66172-2-Ig (same clone as 66172-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human appendicitis tissue slide using 66172-2-Ig (MSH6 antibody) at dilution of 1:5000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). The staining was performed on an autostainer. This data was developed using the same antibody clone with 66172-2-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 66172-2-Ig (same clone as 66172-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66172-2-Ig (MSH6 antibody) at dilution of 1:5000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). The staining was performed on an autostainer. This data was developed using the same antibody clone with 66172-2-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary cancer using 66172-2-Ig (same clone as 66172-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 66172-2-Ig (MSH6 antibody) at dilution of 1:5000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). The staining was performed on an autostainer. This data was developed using the same antibody clone with 66172-2-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colorectal cancer using 66172-2-Ig (same clone as 66172-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human colorectal cancer tissue slide using 66172-2-Ig (MSH6 antibody) at dilution of 1:5000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). The staining was performed on an autostainer. This data was developed using the same antibody clone with 66172-2-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 66172-2-Ig (same clone as 66172-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 66172-2-Ig (MSH6 antibody) at dilution of 1:5000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). The staining was performed on an autostainer. This data was developed using the same antibody clone with 66172-2-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 66172-2-Ig (same clone as 66172-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 66172-2-Ig (MSH6 antibody) at dilution of 1:5000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). The staining was performed on an autostainer. This data was developed using the same antibody clone with 66172-2-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 66172-2-Ig (same clone as 66172-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 66172-2-Ig (MSH6 antibody) at dilution of 1:5000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). The staining was performed on an autostainer. This data was developed using the same antibody clone with 66172-2-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 66172-2-Ig (same clone as 66172-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66172-2-Ig (MSH6 antibody) at dilution of 1:10000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66172-2-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 66172-2-Ig (same clone as 66172-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human normal colon slide using 66172-2-Ig (MSH6 antibody) at dilution of 1:4000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66172-2-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 66172-2-Ig (same clone as 66172-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66172-2-Ig (MSH6 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66172-2-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 66172-2-Ig (same clone as 66172-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66172-2-Ig (MSH6 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66172-2-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human appendicitis using 66172-2-Ig (same clone as 66172-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human appendicitis tissue slide using 66172-2-Ig (MSH6 antibody) at dilution of 1:10000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66172-2-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human rectal cancer using 66172-2-Ig (same clone as 66172-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human rectal cancer tissue slide using 66172-2-Ig (MSH6 antibody) at dilution of 1:10000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66172-2-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colorectal cancer using 66172-2-Ig (same clone as 66172-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human colorectal cancer tissue slide using 66172-2-Ig (MSH6 antibody) at dilution of 1:5000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66172-2-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colorectal cancer using 66172-2-Ig (same clone as 66172-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human colorectal cancer tissue slide using 66172-2-Ig (MSH6 antibody) at dilution of 1:5000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66172-2-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 66172-2-Ig (same clone as 66172-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 66172-2-Ig (MSH6 antibody) at dilution of 1:5000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66172-2-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary cancer using 66172-2-Ig (same clone as 66172-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 66172-2-Ig (MSH6 antibody) at dilution of 1:5000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66172-2-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 66172-2-Ig (same clone as 66172-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 66172-2-Ig (MSH6 antibody) at dilution of 1:5000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66172-2-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 66172-2-Ig (same clone as 66172-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 66172-2-Ig (MSH6 antibody) at dilution of 1:5000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66172-2-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human appendicitis using 66172-2-Ig (same clone as 66172-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human appendicitis tissue slide using 66172-2-Ig (MSH6 antibody) at dilution of 1:5000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66172-2-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 66172-2-Ig (same clone as 66172-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66172-2-Ig (MSH6 antibody) at dilution of 1:5000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66172-2-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 66172-2-Ig (same clone as 66172-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66172-2-Ig (MSH6 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66172-2-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 66172-2-Ig (same clone as 66172-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66172-2-Ig (MSH6 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66172-2-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Cytometric bead array standard curve of MP50291-1

  Cytometric bead array standard curve of MP50291-1, MSH6 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 66172-2-PBS. Detection antibody: 66172-3-PBS. Standard:Ag12645. Range: 3.125-200 ng/mL.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Cytometric bead array standard curve of MP50291-2

  Cytometric bead array standard curve of MP50291-2, MSH6 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 66172-2-PBS. Detection antibody: 66172-4-PBS. Standard:Ag12645. Range: 6.25-200 ng/mL.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for MSH6 in ?

Chat with Able

---

Product Information

66172-2-PBS targets MSH6 as part of a matched antibody pair:

MP50291-1: 66172-2-PBS capture and 66172-3-PBS detection (validated in Cytometric bead array)

MP50291-2: 66172-2-PBS capture and 66172-4-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12645

  Product name: Recombinant human MSH6 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-400 aa of BC004246

  Sequence: MSRQSTLYSFFPKSPALSDANKASARASREGGRAAAAPGASPSPGGDAAWSEAGPGPRPLARSASPPKAKNLNGGLRRSVAPAAPTSCDFSPGDLVWAKMEGYPWWPCLVYNHPFDGTFIREKGKSVRVHVQFFDDSPTRGWVSKRLLKPYTGSKSKEAQKGGHFYSAKPEILRAMQRADEALNKDKIKRLELAVCDEPSEPEEEEEMEVGTTYVTDKSEEDNEIESEEEVQPKTQGSRRSSRQIKKRRVISDSESDIGGSDVEFKPDTKEEGSSDEISSGVGDSESEGLNSPVKVARKRKRMVTGNGSLKRKSSRKETPSATKQATSISSETKNTLRAFSAPQNSESQAHVSGGGDDSSRPTVWYHETLEWLKEEKRRDEHRRRPDHPDFDASTLYVPE

• Full Name: mutS homolog 6 (E. coli)
• Calculated Molecular Weight: 153 kDa
• Observed Molecular Weight: 150-160 kDa
• GenBank Accession Number: BC004246
• Gene Symbol: MSH6
• Gene ID (NCBI): 2956
• RRID: AB_3743303
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P52701
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MSH6, also named as DNA mismatch repair protein Msh6 or GTMBP, is a 1360 amino acid protein, which contains one PWWP domain and belongs to the DNA mismatch repair MutS family. MSH6 localizes in the nucleus and is a component of the post-replicative DNA mismatch repair system. Msh2 and Msh6 form a protein complex required to repair mismatches generated during DNA replication.