MSI1 Recombinant monoclonal antibody, PBS Only (Capture)

• 

  WB analysis using 86723-1-RR (same clone as 86723-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86723-1-RR (MSI1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86723-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 86723-1-RR (same clone as 86723-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86723-1-RR (MSI1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86723-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse embryo using 86723-1-RR (same clone as 86723-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse embryo tissue slide using 86723-1-RR (MSI1 antibody) at dilution of 1:8000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86723-1-PBS in a different storage buffer formulation.

• 

  Cytometric bead array sample test of MP02619-1

  The mean MSI1 concentration was determined to be 12.9 ng/mL in HEK-293 cell extract based on a 1.2 mg/mL extract load, 9.0 ng/mL in Caco-2 cell extract based on a 1.3 mg/mL extract load, 20.7 ng/mL in HEK-293T cell extract based on a 2.6 mg/mL extract load.

• 

  Cytometric bead array standard curve of MP02619-1

  Cytometric bead array standard curve of MP02619-1, MSI1 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 86723-1-PBS. Detection antibody: 86723-2-PBS. Standard: Ag26042. Range: 0.312-40 ng/mL.

• 

  Affinity and Kinetic Characterization of 86723-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86723-1-RR against Human MSI1 were performed. The affinity constant is 93.8 pM.

MSI1 Uni-rAb^® Recombinant Antibody for WB, IHC, Cytometric bead array, Indirect ELISA

Cat No. 86723-1-PBS

Clone No.251695G8

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Cytometric bead array, Indirect ELISA

Synonyms

Musashi 1, musashi homolog 1 (Drosophila), Musashi-1, RNA-binding protein Musashi homolog 1

---

Product Information

86723-1-PBS targets MSI1 as part of a matched antibody pair:

MP02619-1: 86723-1-PBS capture and 86723-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag26042

  Product name: Recombinant human MSI1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-83 aa of BC146463

  Sequence: METDAPQPGLASPDSPHDPCKMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRH

• Full Name: musashi homolog 1 (Drosophila)
• Calculated Molecular Weight: 362 aa, 39 kDa
• Observed Molecular Weight: 37-40 kDa
• GenBank Accession Number: BC146463
• Gene Symbol: MSI1
• Gene ID (NCBI): 4440
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O43347
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Musashi1 (Msi1) is an RNA-binding protein expressed in neural progenitor cells and neural stem cells. The gene encoding human Msi1 encodes a 362 amino acid protein. In murine embryonic neural progenitor cells, Msi1 localizes to the cytoplasm and is downregulated during differentiation. Msi1 binds to NUMB, which encodes a membrane-associated antagonist of Notch signaling. Msi1 appears to function in the proliferation and maintenance of stem cell populations of the central nervous system. In addition to its usefulness as a marker for neural progenitor cells in normal human brains, Msi1 is also a marker for human gliomas. In rats, Msi1 is expressed in Sertoli cells of the testis and granulosa cells of the ovary.