Tested Applications
| Positive WB detected in | HEK-293T cells, mouse brain tissue, SH-SY5Y cells, COLO 320 cells, Neuro-2a cells, PC-12 cells, rat brain tissue |
| Positive IHC detected in | mouse embryo tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:4000-1:16000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
86723-1-RR targets MSI1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag26042 Product name: Recombinant human MSI1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-83 aa of BC146463 Sequence: METDAPQPGLASPDSPHDPCKMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRH Predict reactive species |
| Full Name | musashi homolog 1 (Drosophila) |
| Calculated Molecular Weight | 362 aa, 39 kDa |
| Observed Molecular Weight | 37-40 kDa |
| GenBank Accession Number | BC146463 |
| Gene Symbol | MSI1 |
| Gene ID (NCBI) | 4440 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | O43347 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Musashi1 (Msi1) is an RNA-binding protein expressed in neural progenitor cells and neural stem cells. The gene encoding human Msi1 encodes a 362 amino acid protein. In murine embryonic neural progenitor cells, Msi1 localizes to the cytoplasm and is downregulated during differentiation. Msi1 binds to NUMB, which encodes a membrane-associated antagonist of Notch signaling. Msi1 appears to function in the proliferation and maintenance of stem cell populations of the central nervous system. In addition to its usefulness as a marker for neural progenitor cells in normal human brains, Msi1 is also a marker for human gliomas. In rats, Msi1 is expressed in Sertoli cells of the testis and granulosa cells of the ovary.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for MSI1 antibody 86723-1-RR | Download protocol |
| WB protocol for MSI1 antibody 86723-1-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
