MSRA Polyclonal antibody

• 

  WB analysis of human kidney using 14547-1-AP

  human kidney tissue were subjected to SDS PAGE followed by western blot with 14547-1-AP (MSRA antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 14547-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14547-1-AP (MSRA antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse kidney using 14547-1-AP

  IP result of anti-MSRA (IP:14547-1-AP, 4ug; Detection:14547-1-AP 1:600) with mouse kidney tissue lysate 4000ug.

• 

  IHC staining of human colon using 14547-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 14547-1-AP (MSRA antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon using 14547-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 14547-1-AP (MSRA antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HEK-293 using 14547-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HEK-293 cells using 14547-1-AP (MSRA antibody), at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

MSRA Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 14547-1-AP

Publications(17)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

Protein-methionine-S-oxide reductase, PMSR, Peptide-methionine, Peptide Met(O) reductase, Mitochondrial peptide methionine sulfoxide reductase

---

Tested Applications

• Positive WB detected in: HT-1080 cells, human kidney tissue, mouse kidney tissue, rat kidney tissue
• Positive IP detected in: mouse kidney tissue
• Positive IHC detected in: human colon tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:10000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 14 publications below
• IHC: See 1 publications below
• IF: See 2 publications below
• IP: See 1 publications below

Product Information

14547-1-AP targets MSRA in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6053

  Product name: Recombinant human MSRA protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-235 aa of BC054033

  Sequence: MLSATRRACQLLLLHSLFPVPRMGNSASNIVSPQEALPGRKEQTPVAAKHHVNGNRTVEPFPEGTQMAVFGMGCFWGAERKFWVLKGVYSTQVGFAGGYTSNPTYKEVCSEKTGHAEVVRVVYQPEHMSFEELLKVFWENHDPTQGMRQGNDHGTQYRSAIYPTSAKQMEAALSSKENYQKVLSEHGFGPITTDIREGQTFYYAEDYHQQYLSKNPNGYCGLGGTGVSCPVGIKK

• Full Name: methionine sulfoxide reductase A
• Calculated Molecular Weight: 26 kDa
• Observed Molecular Weight: 24-26 kDa
• GenBank Accession Number: BC054033
• Gene Symbol: MSRA
• Gene ID (NCBI): 4482
• RRID: AB_2148366
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UJ68
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Methionine sulfoxide reductase A(MSRA), is a ubiquitous and highly conserved protein that carries out the enzymatic reduction of methionine sulfoxide to methionine.MSRA has some isoforms with MW of 19~26 kDa. MSRA functions in the repair of oxidatively damaged proteins to restore biological activity. Transfection of MSRA reduced colony formation and the invasiveness of HCC cell lines.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	WB	Cell Rep; Inhibiting G6PD by quercetin promotes degradation of EGFR T790M mutation; Authors - Zehe Ge
rat	WB	Oxid Med Cell Longev; Fecal Microbiota Transplantation Is a Promising Method to Restore Gut Microbiota Dysbiosis and Relieve Neurological Deficits after Traumatic Brain Injury.; Authors - Donglin Du
mouse	WB	Free Radic Biol Med; Loss of methionine sulfoxide reductases increases resistance to oxidative stress.; Authors - Lo Lai
human	WB	Proteomics; Analysis of EV71 infection progression using triple-SILAC-based proteomics approach.; Authors - Hao-Yu Li
human	WB	Toxicol Appl Pharmacol; Methionine redox regulation of actin-interacting proteins primarily governs antioxidative signaling and response to the salvianolic acid B treatment in EA.hy926 cells; Authors - Ai-Cheng Wang
rat	WB	J Med Food; Rice Protein Exerts Endogenous Antioxidant Capacity via Methionine Sulfoxide Reductase and the Nrf2 Antioxidant System Independent of Age.; Authors - Hui Li

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Hua (Verified Customer) (12-01-2020)

Clear band with clean background. The signal is a little weak.

• Applications: Western Blot
• Primary Antibody Dilution: 1:500
• Cell Tissue Type: Mouse liver

MSRA Antibody Western Blot validation (1:500 dilution) in Mouse liver (Cat no:14547-1-AP)