CoraLite® Plus 488-conjugated MSRA Polyclonal antibody

• 

  IF Staining of HEK-293 using CL488-14547

  Immunofluorescent analysis of (-20°C Ethanol) fixed HEK-293 cells using CoraLite® Plus 488 MSRA antibody (CL488-14547) at dilution of 1:200.

MSRA Polyclonal Antibody for IF/ICC

Cat No. CL488-14547

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

Synonyms

Protein-methionine-S-oxide reductase, PMSR, Peptide-methionine, Peptide Met(O) reductase, Mitochondrial peptide methionine sulfoxide reductase

---

Tested Applications

• Positive IF/ICC detected in: HEK-293 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-14547 targets MSRA in IF/ICC applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6053

  Product name: Recombinant human MSRA protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-235 aa of BC054033

  Sequence: MLSATRRACQLLLLHSLFPVPRMGNSASNIVSPQEALPGRKEQTPVAAKHHVNGNRTVEPFPEGTQMAVFGMGCFWGAERKFWVLKGVYSTQVGFAGGYTSNPTYKEVCSEKTGHAEVVRVVYQPEHMSFEELLKVFWENHDPTQGMRQGNDHGTQYRSAIYPTSAKQMEAALSSKENYQKVLSEHGFGPITTDIREGQTFYYAEDYHQQYLSKNPNGYCGLGGTGVSCPVGIKK

• Full Name: methionine sulfoxide reductase A
• Calculated Molecular Weight: 26 kDa
• Observed Molecular Weight: 24-26 kDa
• GenBank Accession Number: BC054033
• Gene Symbol: MSRA
• Gene ID (NCBI): 4482
• RRID: AB_3672591
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UJ68
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Methionine sulfoxide reductase A(MSRA), is a ubiquitous and highly conserved protein that carries out the enzymatic reduction of methionine sulfoxide to methionine.MSRA has some isoforms with MW of 19~26 kDa. MSRA functions in the repair of oxidatively damaged proteins to restore biological activity. Transfection of MSRA reduced colony formation and the invasiveness of HCC cell lines.