CoraLite® Plus 488-conjugated MSRA Polyclonal antibody

MSRA Polyclonal Antibody for IF/ICC
Cat No. CL488-14547

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

Protein-methionine-S-oxide reductase, PMSR, Peptide-methionine, Peptide Met(O) reductase, Mitochondrial peptide methionine sulfoxide reductase

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHEK-293 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-14547 targets MSRA in IF/ICC applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag6053

Product name: Recombinant human MSRA protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-235 aa of BC054033

Sequence: MLSATRRACQLLLLHSLFPVPRMGNSASNIVSPQEALPGRKEQTPVAAKHHVNGNRTVEPFPEGTQMAVFGMGCFWGAERKFWVLKGVYSTQVGFAGGYTSNPTYKEVCSEKTGHAEVVRVVYQPEHMSFEELLKVFWENHDPTQGMRQGNDHGTQYRSAIYPTSAKQMEAALSSKENYQKVLSEHGFGPITTDIREGQTFYYAEDYHQQYLSKNPNGYCGLGGTGVSCPVGIKK

Predict reactive species
Full Name methionine sulfoxide reductase A
Calculated Molecular Weight 26 kDa
Observed Molecular Weight 24-26 kDa
GenBank Accession NumberBC054033
Gene Symbol MSRA
Gene ID (NCBI) 4482
RRIDAB_3672591
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9UJ68
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Methionine sulfoxide reductase A(MSRA), is a ubiquitous and highly conserved protein that carries out the enzymatic reduction of methionine sulfoxide to methionine.MSRA has some isoforms with MW of 19~26 kDa. MSRA functions in the repair of oxidatively damaged proteins to restore biological activity. Transfection of MSRA reduced colony formation and the invasiveness of HCC cell lines.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 MSRA antibody CL488-14547Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...