MSTO1 Polyclonal antibody

• 

  WB analysis using 28400-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28400-1-AP (MSTO1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 28400-1-AP

  WB result of MSTO1 antibody (28400-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-MSTO1 transfected HepG2 cells.

• 

  IHC staining of human ovary cancer using 28400-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 28400-1-AP (MSTO1 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human ovary cancer using 28400-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 28400-1-AP (MSTO1 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

MSTO1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 28400-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

SLTP005, MST, MMYAT, LST005

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells
• Positive IHC detected in: human ovary cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28400-1-AP targets MSTO1 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29067

  Product name: Recombinant human MSTO1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 28-256 aa of BC002535

  Sequence: QDAALGRATDSKEPPGELCPDVLYRTGRTLHGQETYTPRLILMDLKGSLSSLKEEGGLYRDKQLDAAIAWQGKLTTHKEELYPKNPYLQDFLSAEGVLSSDGVWRVKSIPNGKGSSPLPTATTPKPLIPTEASIRVWSDFLRVHLHPRSICMIQKYNHDGEAGRLEAFGQGESVLKEPKYQEELEDRLHFYVEECDYLQGFQILCDLHDGFSGVGAKAAELLQDEYSGR

• Full Name: misato homolog 1 (Drosophila)
• Observed Molecular Weight: 57-62 kDa
• GenBank Accession Number: BC002535
• Gene Symbol: MSTO1
• Gene ID (NCBI): 55154
• RRID: AB_2881133
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BUK6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MSTO1, also named as LST005 and SLTP005, belongs to the misato family. Human MSTO1 is a ubiquitously expressed, evolutionary conserved protein with homologous regions to GTPases. MSTO1 is a cytoplasmic protein that modulates mitochondrial dynamics by promoting mitochondrial fusion. MSTO1 has 7 isoforms produced by alternative splicing. (PMID: 33612823)