• Featured Product
  • KD/KO Validated

MSTO1 Polyclonal antibody

MSTO1 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 28400-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

SLTP005, MST, MMYAT, LST005

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HepG2 cells
Positive IHC detected inhuman ovary cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

28400-1-AP targets MSTO1 in WB, IHC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag29067

Product name: Recombinant human MSTO1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 28-256 aa of BC002535

Sequence: QDAALGRATDSKEPPGELCPDVLYRTGRTLHGQETYTPRLILMDLKGSLSSLKEEGGLYRDKQLDAAIAWQGKLTTHKEELYPKNPYLQDFLSAEGVLSSDGVWRVKSIPNGKGSSPLPTATTPKPLIPTEASIRVWSDFLRVHLHPRSICMIQKYNHDGEAGRLEAFGQGESVLKEPKYQEELEDRLHFYVEECDYLQGFQILCDLHDGFSGVGAKAAELLQDEYSGR

Predict reactive species
Full Name misato homolog 1 (Drosophila)
Observed Molecular Weight 57-62 kDa
GenBank Accession NumberBC002535
Gene Symbol MSTO1
Gene ID (NCBI) 55154
RRIDAB_2881133
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9BUK6
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MSTO1, also named as LST005 and SLTP005, belongs to the misato family. Human MSTO1 is a ubiquitously expressed, evolutionary conserved protein with homologous regions to GTPases. MSTO1 is a cytoplasmic protein that modulates mitochondrial dynamics by promoting mitochondrial fusion. MSTO1 has 7 isoforms produced by alternative splicing. (PMID: 33612823)

Protocols

Product Specific Protocols
IHC protocol for MSTO1 antibody 28400-1-APDownload protocol
WB protocol for MSTO1 antibody 28400-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...