ATP8 Polyclonal antibody

• 

  WB analysis of 143B.TK.P0 using 29398-1-AP

  WB result of ATP8 antibody (ATP8; 1:1000; incubated at room temperature for 1.5 hours) with 143B and 143B.TK.ρ0 cell. 143B is wild-type cell line, 143B.TK.ρ0 is mtDNA deletion cell line.

• 

  WB analysis using 29398-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29398-1-AP (MT-ATP8 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• Featured Product
• KD/KO Validated

ATP8 Polyclonal Antibody for WB, ELISA

Cat No. 29398-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

MT-ATP8

---

Tested Applications

• Positive WB detected in: HEK-293 cells, 143B cells, HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

29398-1-AP targets ATP8 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30024

  Product name: Recombinant human MT-ATP8 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-68 aa of

  Sequence: MPQLNTTVWPTMITPMLLTLFLITQLKMLNTNYHLPPSPKPMKMKNYNKPWEPKWTKICSLHSLPPQS

• Full Name: ATP synthase 8; ATPase subunit 8
• Calculated Molecular Weight: 8 kDa
• Observed Molecular Weight: 8-10 kDa
• Gene Symbol: ATP8
• Gene ID (NCBI): 4509
• RRID: AB_2918293
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P03928
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.