MT1X Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MT1X Polyclonal antibody, PBS Only (17172-1-PBS)

• 

  IHC staining of human liver using 17172-1-AP (same clone as 17172-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 17172-1-AP (MT1X antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 17172-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 17172-1-AP (same clone as 17172-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 17172-1-AP (MT1X antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 17172-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human hepatocirrhosis using 17172-1-AP (same clone as 17172-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis tissue slide using 17172-1-AP (MT1X antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17172-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human hepatocirrhosis using 17172-1-AP (same clone as 17172-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis tissue slide using 17172-1-AP (MT1X antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17172-1-PBS in a different storage buffer formulation.

MT1X Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 17172-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, Indirect ELISA

Synonyms

metallothionein 1X, Metallothionein IX, Metallothionein-1X, Metallothionein-IX, MT 1l

---

Product Information

17172-1-PBS targets MT1X in IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10711

  Product name: Recombinant human MT1X protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-46 aa of BC032131

  Sequence: MDPNCSCSPVGSCACAGSCKCKECKCTSCKKSECRAFPANLGDGPI

• Full Name: metallothionein 1X
• Calculated Molecular Weight: 46 aa, 5 kDa
• GenBank Accession Number: BC032131
• Gene Symbol: MT1X
• Gene ID (NCBI): 4501
• RRID: AB_2878354
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: U3KQD7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.