MTF1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• MTF1 Polyclonal antibody (25383-1-AP)

• Featured Product
• KD/KO Validated

MTF1 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 25383-1-AP Copied!

Publications (43)

Reviews (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (2)

Applications

WB, IHC, IF, IP, chIP, ELISA

Synonyms

MTF 1, Transcription factor MTF 1, Transcription factor MTF-1, ZRF

• 

  WB analysis of mouse liver using 25383-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 25383-1-AP (MTF1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse skeletal muscle using 25383-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 25383-1-AP (MTF1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse heart using 25383-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 25383-1-AP (MTF1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 25383-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 25383-1-AP (MTF1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Jurkat using 25383-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 25383-1-AP (MTF1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HepG2 using 25383-1-AP

  IP result of anti-MTF1 (IP:25383-1-AP, 4ug; Detection:25383-1-AP 1:3000) with HepG2 cells lysate 1600 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 25383-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 25383-1-AP (MTF1 Antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 25383-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 25383-1-AP (MTF1 Antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for MTF1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse liver tissue, Jurkat cells, mouse brain tissue, mouse heart tissue, mouse skeletal muscle tissue
• Positive IP detected in: HepG2 cells
• Positive IHC detected in: human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25383-1-AP targets MTF1 in WB, IHC, IF, IP, chIP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat, fish
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21848

  Product name: Recombinant human MTF1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 404-753 aa of BC014454

  Sequence: VSDVPPSTGNSASLSLPLVLQPGLSEPPQPLLPASAPSAPPPAPSLGPGSQQAAFGNPPALLQPPEVPVPHSTQFAANHQEFLPHPQAPQPIVPGLSVVAGASASAAAVASAVAAPAPPQSTTEPLPAMVQTLPLGANSVLTNNPTITITPTPNTAILQSSLVMGEQNLQWILNGATSSPQNQEQIQQASKVEKVFFTTAVPVASSPGSSVQQIGLSVPVIIIKQEEACQCQCACRDSAKERASSRRKGCSSPPPPEPSPQAPDGPSLQLPAQTFSSAPVPGSSSSTLPSSCEQSRQAETPSDPQTETLSAMDVSEFLSLQSLDTPSNLIPIEALLQGEEEMGLTSSFSK

• Full Name: metal-regulatory transcription factor 1
• Calculated Molecular Weight: 753 aa, 81 kDa
• Observed Molecular Weight: 65-70 kDa, 100 kDa
• GenBank Accession Number: BC014454
• Gene Symbol: MTF1
• Gene ID (NCBI): 4520
• RRID: AB_2880053
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q14872
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Metal regulatory transcription factor 1 (MTF1), contains six C2H2-type zinc finger and localizes in the nucleus. MTF1 is a 753 amino acid protein and calculated molecular weight is 81 kDa. We always dectected a 65-70 protein by western blot. MTF1 binds to the metal responsive element and activates the metallothionein I promoter.

Publications

What published studies show

The MTF1 antibody (Cat# 25383-1-AP) has 43 citations across journals including Cell, Cancer Cell, Nat Commun, ACS Nano, Sci Adv, FASEB J, Free Radic Biol Med, Cell Rep, Adv Sci, and Environ Sci Technol. Research fields span cuproptosis, zinc/copper homeostasis, metal metabolism, cancer biology, oxidative stress, ferroptosis, lipid metabolism, neuroprotection, reproductive toxicity, and environmental toxicology.

Automatically generated from the 43 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse,human	WB	Cancer Cell; Hypoxia inducible factor-1α drives cancer resistance to cuproptosis; Authors - Zhou Yang
		Cell; Cuproptosis-immunity crosstalk informs strategy to overcome immunotherapy resistance.; Authors - Guang Lei
		Cell; Cuproptosis-immunity crosstalk informs strategy to overcome immunotherapy resistance.; Authors - Guang Lei
human	WB	Nat Commun; Autophagy of the m6A mRNA demethylase FTO is impaired by low-level arsenic exposure to promote tumorigenesis.; Authors - Yan-Hong Cui ; KD Validated
mouse	WB	ACS Nano; Amplification of Metalloregulatory Proteins in Macrophages by Bioactive ZnMn@SF Hydrogels for Spinal Cord Injury Repair; Authors - Xiaoliang Cui
human	WB	ACS Nano; A CRISPR-Customizable Copper-Coordinated DNA Nanoplatform Potentiates Cuproptosis Through Circadian and Metabolic Pathway Manipulation.; Authors - Wenxian Zhang

Reviews

5.0 out of 5

1 verified customer reviews

What customers say

The single review for this product rates it 5 out of 5 stars. The reviewer used it for Western Blot at a 1:1000 dilution and reported a strong, clean signal, describing the performance as "pretty good." Overall, the feedback is positive, highlighting reliable detection with minimal background.

Automatically generated from the 1 verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

David (Verified Customer) (09-15-2025)

Concentration used 1:1000. Works pretty good. Strong clean signal

• Applications: Western Blot