MTF1 Polyclonal antibody

• 

  WB analysis of mouse liver using 25383-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 25383-1-AP (MTF1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse skeletal muscle using 25383-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 25383-1-AP (MTF1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse heart using 25383-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 25383-1-AP (MTF1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 25383-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 25383-1-AP (MTF1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 25383-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 25383-1-AP (MTF1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver using 25383-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 25383-1-AP (MTF1 Antibody) at dilution of 1:200 (under 40x lens).

• 

  IHC staining of human liver using 25383-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 25383-1-AP (MTF1 Antibody) at dilution of 1:200 (under 10x lens).

• Featured Product
• KD/KO Validated

MTF1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 25383-1-AP

Publications(36)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (2)

Applications

WB, IHC, IF, IP, chIP, ELISA

Synonyms

MTF 1, Transcription factor MTF 1, Transcription factor MTF-1, ZRF

---

Tested Applications

• Positive WB detected in: mouse liver tissue, Jurkat cells, mouse brain tissue, mouse heart tissue, mouse skeletal muscle tissue
• Positive IHC detected in: human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 5 publications below
• WB: See 27 publications below
• IHC: See 5 publications below
• IF: See 3 publications below
• IP: See 1 publications below
• ChIP: See 5 publications below

Product Information

25383-1-AP targets MTF1 in WB, IHC, IF, IP, chIP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat, fish
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21848

  Product name: Recombinant human MTF1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 404-753 aa of BC014454

  Sequence: VSDVPPSTGNSASLSLPLVLQPGLSEPPQPLLPASAPSAPPPAPSLGPGSQQAAFGNPPALLQPPEVPVPHSTQFAANHQEFLPHPQAPQPIVPGLSVVAGASASAAAVASAVAAPAPPQSTTEPLPAMVQTLPLGANSVLTNNPTITITPTPNTAILQSSLVMGEQNLQWILNGATSSPQNQEQIQQASKVEKVFFTTAVPVASSPGSSVQQIGLSVPVIIIKQEEACQCQCACRDSAKERASSRRKGCSSPPPPEPSPQAPDGPSLQLPAQTFSSAPVPGSSSSTLPSSCEQSRQAETPSDPQTETLSAMDVSEFLSLQSLDTPSNLIPIEALLQGEEEMGLTSSFSK

• Full Name: metal-regulatory transcription factor 1
• Calculated Molecular Weight: 753 aa, 81 kDa
• Observed Molecular Weight: 65-70 kDa, 100 kDa
• GenBank Accession Number: BC014454
• Gene Symbol: MTF1
• Gene ID (NCBI): 4520
• RRID: AB_2880053
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q14872
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Metal regulatory transcription factor 1 (MTF1), contains six C2H2-type zinc finger and localizes in the nucleus. MTF1 is a 753 amino acid protein and calculated molecular weight is 81 kDa. We always dectected a 65-70 protein by western blot. MTF1 binds to the metal responsive element and activates the metallothionein I promoter.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse,human	WB	Cancer Cell; Hypoxia inducible factor-1α drives cancer resistance to cuproptosis; Authors - Zhou Yang
human	WB	Adv Sci (Weinh); LncRNA MT1DP Aggravates Cadmium-Induced Oxidative Stress by Repressing the Function of Nrf2 and is Dependent on Interaction with miR-365.; Authors - Ming Gao ; KD Validated
human	WB	Nat Commun; Autophagy of the m6A mRNA demethylase FTO is impaired by low-level arsenic exposure to promote tumorigenesis.; Authors - Yan-Hong Cui ; KD Validated
fish	WB,IP	Environ Sci Technol; Zn Induces Lipophagy via the Deacetylation of Beclin1 and Alleviates Cu-Induced Lipotoxicity at Their Environmentally Relevant Concentrations.; Authors - Xiaolei Wei
	WB	Environ Sci Technol; Mitochondria-Dependent Oxidative Stress Mediates ZnO Nanoparticle (ZnO NP)-Induced Mitophagy and Lipotoxicity in Freshwater Teleost Fish.; Authors - Guang-Hui Chen
human	WB,IHC	Oxid Med Cell Longev; Ferroportin-Dependent Iron Homeostasis Protects against Oxidative Stress-Induced Nucleus Pulposus Cell Ferroptosis and Ameliorates Intervertebral Disc Degeneration In Vivo.; Authors - Saideng Lu

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

David (Verified Customer) (09-15-2025)

Concentration used 1:1000. Works pretty good. Strong clean signal

• Applications: Western Blot