MTF2 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 82944-1-RR (same clone as 82944-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 82944-1-RR (MTF2 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 82944-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 82944-1-RR (same clone as 82944-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using MTF2 antibody (82944-1-RR, Clone: 230138D10 ) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 82944-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HEK-293 using 82944-1-RR (same clone as 82944-1-PBS)

  1x10^6 HEK-293 cells were intracellularly stained with 0.25 ug MTF2 Recombinant antibody (82944-1-RR, Clone:230138D10) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9) (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 82944-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 82944-1-RR

  Biolayer interferometry (BLl) kinetic assays of 82944-1-RR against Human MTF2 were performed. The affinity constant is 0.398 nM.

MTF2 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 82944-1-PBS

Clone No.230138D10

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

MTF 2, Metal-response element-binding transcription factor 2, Metal-response element DNA-binding protein M96, M96, hPCl2

---

Product Information

82944-1-PBS targets MTF2 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag9384

  Product name: Recombinant human MTF2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 187-536 aa of BC010013

  Sequence: ADLEWDAGHKTNVQQCYCYCGGPGDWYLKMLQCCKCKQWFHEACVQCLQKPMLFGDRFYTFICSVCSSGPEYLKRLPLQWVDIAHLCLYNLSVIHKKKYFDSELELMTYINENWDRLHPGELADTPKSERYEHVLEALNDYKTMEVSNGIEKKGKKKSVGRPPGPYTRKMIQKTAEPLLDKESISENPTLDLPCSIGRTEGTAHSSNTSDVDFTGASSAKETTSSSISRHYGLSDSRKRTRTGRSWPAAIPHLRRRRGRLPRRALQTQNSEIVKDDEGKEDYQFDELNTEILNNLADQELQLNHLKNSITSYFGAAGRIACGEKYRVLARRVTLDGKVQYLVEWEGATAS

• Full Name: metal response element binding transcription factor 2
• Calculated Molecular Weight: 536 aa, 61 kDa
• Observed Molecular Weight: 55 kDa, 60 kDa, 75 kDa
• GenBank Accession Number: BC010013
• Gene Symbol: MTF2
• Gene ID (NCBI): 22823
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9Y483
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MTF2, also named as Metal-response element-binding transcription factor 2, is a 593 amino acid protein. It exists several isoforms and the range of the molecular weight of isoforms are about 55-60 kDa and 29 kDa. MTF2 contains 2 PHD-type zinc fingers and belongs to the Polycomblike family. MTF2 acts by binding to H3K36me3, a mark for transcriptional activation, and recruiting the PRC2 complex, leading to enhance PRC2 H3K27me3 methylation activity and regulates the transcriptional networks during embryonic stem cell self-renewal and differentiation.