Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

MTHFD1 Monoclonal antibody

MTHFD1 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 67670-1-Ig
Clone No. 2B1G3
Publications (2)
Reviews (1)
Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA
For FC, select conjugated version.

2B1G3, C-1-tetrahydrofolate synthase, cytoplasmic, C-1-tetrahydrofolate synthase, cytoplasmic, N-terminally processed, C1-THF synthase, Epididymis secretory sperm binding protein

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for MTHFD1 in ?

Tested Applications

Positive WB detected inU2OS cells, HEK-293 cells, A431 cells, A549 cells, HeLa cells, Jurkat cells, HSC-T6 cells, NIH/3T3 cells, 4T1 cells
Positive IHC detected inhuman colon cancer tissue, human liver cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHEK-293 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunohistochemistry (IHC)IHC : 1:250-1:1000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67670-1-Ig targets MTHFD1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag24553

Product name: Recombinant human MTHFD1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 536-935 aa of BC009806

Sequence: TNDRFLRKITIGQAPTEKGHTRTAQFDISVASEIMAVLALTTSLEDMRERLGKMVVASSKKGEPVSAEDLGVSGALTVLMKDAIKPNLMQTLEGTPVFVHAGPFANIAHGNSSIIADQIALKLVGPEGFVVTEAGFGADIGMEKFFNIKCRYSGLCPHVVVLVATVRALKMHGGGPTVTAGLPLPKAYIQENLELVEKGFSNLKKQIENARMFGIPVVVAVNAFKTDTESELDLISRLSREHGAFDAVKCTHWAEGGKGALALAQAVQRAAQAPSSFQLLYDLKLPVEDKIRIIAQKIYGADDIELLPEAQHKAEVYTKQGFGNLPICMAKTHLSLSHNPEQKGVPTGFILPIRDIRASVGAGFLYPLVGTMSTMPGLPTRPCFYDIDLDPETEQVNGLF

Predict reactive species
Full Name methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1, methenyltetrahydrofolate cyclohydrolase, formyltetrahydrofolate synthetase
Calculated Molecular Weight 101 kDa
Observed Molecular Weight 101 kDa
GenBank Accession NumberBC009806
Gene Symbol MTHFD1
Gene ID (NCBI) 4522
RRIDAB_2882866
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP11586
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MTHFD1 is a trifunctional enzyme involved in the pathway tetrahydrofolate interconversion, which is part of One-carbon metabolism. MTHFD1 is associated with HCC and CRC progression. It has been reported that MTHFD-deficient patient fibroblasts exhibit enriched MTHFD1 in the nucleus which is critical for de novo dTMP synthesis.(PMID: 31133746, 30997850, 31421459, 25548164)

Protocols

Product Specific Protocols
IF protocol for MTHFD1 antibody 67670-1-IgDownload protocol
IHC protocol for MTHFD1 antibody 67670-1-IgDownload protocol
WB protocol for MTHFD1 antibody 67670-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The MTHFD1 Monoclonal antibody (2B1G3), catalog number 67670-1-Ig, has 2 total citations. These citations appear in Journal of Biological Chemistry and Frontiers in Oncology. The research fields encompass mitochondrial folate metabolism in liver fibrosis resolution and RNA methylation-related gene biology in gallbladder carcinoma. Both studies utilized the antibody for Western blot analysis in human samples.

SpeciesApplicationTitle
humanWB

J Biol Chem

Mitochondrial folate metabolism-mediated α-linolenic acid exhaustion masks liver fibrosis resolution

Authors - Yanjie Gao
  • KD Validated
humanWB

Front Oncol

Mining of RNA Methylation-Related Genes and Elucidation of Their Molecular Biology in Gallbladder Carcinoma.

Authors - Changhong Yang

Reviews

    4.0 out of 5
Add a review

1 verified customer reviews

What customers say

The single review for this product (lot 10017178) was submitted by Hua Jiang on December 1, 2020, for Western Blot on mouse liver tissue at a 1:4000 dilution. The reviewer gave a 4-star rating, noting a clean background and good performance at high dilution, while mentioning an extra non-specific band around 70 kDa.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Hua (Verified Customer) (12-01-2020)

Clean background. High dilution. There is an extra non-specific band around 70 kDa.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:4000
  • Cell Tissue Type: Mouse liver
MTHFD1 Antibody Western Blot validation (1:4000 dilution) in Mouse liver (Cat no:67670-1-Ig)
Loading...
||
New chat

Able™

正在加载,请稍候...